SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42055_T100
Price: $0.00
SKU
ARP42055_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SERPINB5 (ARP42055_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SERPINB5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 93%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
Concentration1.0 mg/ml
Blocking PeptideFor anti-SERPINB5 (ARP42055_T100) antibody is Catalog # AAP42055 (Previous Catalog # AAPS11603)
ReferenceVereecken,P., (2006) J. Int. Med. Res. 34 (1), 52-57
Publications

Hrabakova, R. et al. Cancer cell resistance to aurora kinase inhibitors: identification of novel targets for cancer therapy. J. Proteome Res. 12, 455-69 (2013). 23151231

Mardin, W. A. et al. SERPINB5 and AKAP12 - expression and promoter methylation of metastasis suppressor genes in pancreatic ductal adenocarcinoma. BMC Cancer 10, 549 (2010). 20939879

SERPINB5 Promoter Hypomethylation Differentiates Pancreatic Ductal Adenocarcinoma From Pancreatitis. Pancreas. 45, 743-7 (2016). 26646275

Gene SymbolSERPINB5
Gene Full NameSerpin peptidase inhibitor, clade B (ovalbumin), member 5
Alias SymbolsPI5, maspin
NCBI Gene Id5268
Protein NameSerpin B5
Description of TargetAs a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Uniprot IDP36952
Protein Accession #NP_002630
Nucleotide Accession #NM_002639
Protein Size (# AA)375
Molecular Weight41kDa
Protein InteractionsSUMO2; WWOX; FBXO32; KHDRBS3; ISG15; UBC; Cdk1; UCHL5; HDAC1;
  1. What is the species homology for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SERPINB5 Antibody - middle region (ARP42055_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    This target may also be called "PI5, maspin" in publications.

  5. What is the shipping cost for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SERPINB5 Antibody - middle region (ARP42055_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SERPINB5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SERPINB5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SERPINB5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SERPINB5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SERPINB5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SERPINB5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SERPINB5 Antibody - middle region (ARP42055_T100)
Your Rating
We found other products you might like!