- Description of Target:
- Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia.
- Gene Symbol:
- REN
- Official Gene Full Name:
- Renin
- Alias Symbols:
- FLJ10761; HNFJ2
- Tissue Tool:
- Find tissues and cell lines supported to express REN.
- Protein Accession# :
- NP_000528
- Nucleotide Accession#:
- NM_000537
- Swissprot Id:
- P00797
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 406
- Molecular Weight:
- 45kDa
- Application:
- WB
- Partner Proteins:
- CTSH
- Immunogen:
- The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- REN antibody - C-terminal region (ARP41409_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Dog: 92%; Guinea pig: 92%; Rabbit: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-REN antibody
- ARP41409_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
- Blocking Peptide:
- For anti-REN antibody is Catalog # AAP41409 (Previous Catalog # AAPP24147)
- Key Reference:
- Lavoie,J.L., (2006) Hypertension 47 (3), 461-466
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-REN antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: REN antibody tested with Human Hepg2 Cells (ARP41409_T100)
Aviva Systems Biology is the original manufacturer of this REN antibody (ARP41409_T100)
Click here to view the REN antibody Western Blot Protocol
Product Datasheet Link: REN antibody (ARP41409_T100)
WB Suggested Anti-REN Antibody Titration: 2.5ug/ml
Positive Control: HepG2
Western Blot image: 
Description of Target: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s REN antibody (ARP41409_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
