SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41835_T100
Price: $0.00
SKU
ARP41835_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PTGS1 (ARP41835_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PTGS1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 93%; Sheep: 79%
Peptide SequenceSynthetic peptide located within the following region: LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE
Concentration1.0 mg/ml
Blocking PeptideFor anti-PTGS1 (ARP41835_T100) antibody is Catalog # AAP41835 (Previous Catalog # AAPP10883)
ReferenceChubb,A.J., (2006) Biochemistry 45 (3), 811-820
Gene SymbolPTGS1
Gene Full NameProstaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Alias SymbolsCOX1, COX3, PHS1, PCOX1, PES-1, PGHS1, PTGHS, PGG/HS, PGHS-1
NCBI Gene Id5742
Protein NameProstaglandin G/H synthase 1
Description of TargetProstaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis. Alternative splicing of this gene generates two transcript variants. The expression of these two transcripts is differentially regulated by relevant cytokines and growth factors.
Uniprot IDP23219
Protein Accession #NP_000953
Nucleotide Accession #NM_000962
Protein Size (# AA)599
Molecular Weight69kDa
Protein InteractionsFBXO6; PTGS2; NCL; CAV2; CAV1; PTGIS; Dlg4; PTGS1; NUCB1;
  1. What is the species homology for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep".

  2. How long will it take to receive "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PTGS1 Antibody - N-terminal region (ARP41835_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    This target may also be called "COX1, COX3, PHS1, PCOX1, PES-1, PGHS1, PTGHS, PGG/HS, PGHS-1" in publications.

  5. What is the shipping cost for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PTGS1 Antibody - N-terminal region (ARP41835_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTGS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTGS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTGS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTGS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTGS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTGS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PTGS1 Antibody - N-terminal region (ARP41835_T100)
Your Rating
We found other products you might like!