PPFIBP1 antibody - N-terminal region (ARP42133_T100)

Catalog#: ARP42133_T100

• Size: 100ug

Human Jurkat

• Description of Target: PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Gene Symbol: PPFIBP1
• Official Gene Full Name: PTPRF interacting protein, binding protein 1 (liprin beta 1)
• Alias Symbols: L2; hSGT2; hSgt2p; SGT2
• Protein Accession#: NP_803193
• Nucleotide Accession#: NM_177444
• Swissprot Id: Q86W92-5
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 170
• Molecular Weight: 19kDa
• Application: WB
• Immunogen: The immunogen for anti-PPFIBP1 antibody: synthetic peptide directed towards the N terminal of human PPFIBP1
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Dog: 92%; Guinea pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
• Blocking Peptide: For anti-PPFIBP1 antibody is Catalog # AAP42133 (Previous Catalog # AAPS11706)
• Key Reference: Kriajevska,M., (2002) J. Biol. Chem. 277 (7), 5229-5235
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-PPFIBP1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PPFIBP1 antibody tested with Human Jurkat Cells (ARP42133_T100)

Aviva Systems Biology is the original manufacturer of this PPFIBP1 antibody (ARP42133_T100)

Click here to view the PPFIBP1 antibody Western Blot Protocol

Product Datasheet Link: PPFIBP1 antibody (ARP42133_T100)

WB Suggested Anti-PPFIBP1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PPFIBP1 antibody (ARP42133_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com