PLIN Antibody - N-terminal region (ARP42057_T100)

Catalog No: ARP42057_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PLIN Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLIN
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PLIN1 (ARP42057_T100) antibody is Catalog # AAP42057 (Previous Catalog # AAPP24536)
• Reference: Moore,H.P., (2005) J. Biol. Chem. 280 (52), 43109-43120

Target Info

• Gene Symbol: PLIN1
• Gene Full Name: Perilipin 1
• Alias Symbols: PERI, PLIN, FPLD4
• NCBI Gene Id: 5346
• Protein Name: Perilipin-1
• Description of Target: PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.
• Uniprot ID: O60240
• Protein Accession #: NP_002657
• Nucleotide Accession #: NM_002666
• Protein Size (# AA): 522
• Molecular Weight: 57kDa
• Protein Interactions: ABHD5; PLIN1; LIPE; PRKACA;