- Description of Target:
- This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
- Gene Symbol:
- PLA2G5
- Official Gene Full Name:
- Phospholipase A2, group V
- Alias Symbols:
- DKFZp686C2294; GV-PLA2; MGC46205; PLA2-10; hVPLA(2); FRFB
- Tissue Tool:
- Find tissues and cell lines supported to express PLA2G5.
- Protein Accession# :
- NP_000920
- Nucleotide Accession#:
- NM_000929
- Swissprot Id:
- P39877
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 138
- Molecular Weight:
- 14kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- PLA2G5 antibody - middle region (ARP41429_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 92%; Bovine: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-PLA2G5 antibody
- ARP41429_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
- Blocking Peptide:
- For anti-PLA2G5 antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167)
- Key Reference:
- Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-PLA2G5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: PLA2G5 antibody tested with Human Fetal Thymus Tissue (ARP41429_P050)
Aviva Systems Biology is the original manufacturer of this PLA2G5 antibody (ARP41429_P050)
Click here to view the PLA2G5 antibody Western Blot Protocol
Product Datasheet Link: PLA2G5 antibody (ARP41429_P050)
WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus
Western Blot image: 
Description of Target: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s PLA2G5 antibody (ARP41429_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
