website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

PLA2G5 antibody - middle region (ARP41429_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PLA2G5
NCBI Gene Id:
5322
Official Gene Full Name:
Phospholipase A2, group V
Protein Name:
Calcium-dependent phospholipase A2
Swissprot Id:
P39877
Protein Accession #:
NP_000920
Nucleotide Accession #:
NM_000929
Alias Symbols:
DKFZp686C2294, GV-PLA2, MGC46205, PLA2-10, hVPLA(2), FRFB
Description of Target:
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
Protein Size (# AA):
138
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLA2G5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLA2G5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Rat: 86%
Complete computational species homology data:
Anti-PLA2G5 (ARP41429_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLA2G4A;
Blocking Peptide:
For anti-PLA2G5 (ARP41429_P050) antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167)
Datasheets / Downloads:
Printable datasheet for anti-PLA2G5 (ARP41429_P050) antibody
Target Reference:
Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444

Product Protocols: PLA2G5 antibody tested with Human Fetal Thymus Tissue (ARP41429_P050)

Aviva Systems Biology is the original manufacturer of this PLA2G5 antibody (ARP41429_P050)

Click here to view the PLA2G5 antibody Western Blot Protocol

Product Datasheet Link: PLA2G5 antibody (ARP41429_P050)

WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus

Western Blot image:


Description of Target: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PLA2G5 antibody (ARP41429_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question