website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PLA2G5 antibody - middle region (ARP41429_P050)

Description of Target:
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
Gene Symbol:
Official Gene Full Name:
Phospholipase A2, group V
NCBI Gene Id:
Alias Symbols:
DKFZp686C2294; GV-PLA2; MGC46205; PLA2-10; hVPLA(2); FRFB
Tissue Tool:
Find tissues and cell lines supported to express PLA2G5.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Calcium-dependent phospholipase A2
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
PLA2G5 antibody - middle region (ARP41429_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%
Species Reactivity:
Human, Dog, Bovine, Rat, Guinea pig, Horse
Datasheets / Downloads:
Printable datasheet for
anti-PLA2G5 antibody
- ARP41429_P050
Peptide Sequence:
Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
Blocking Peptide:
For anti-PLA2G5 antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167)
Target Reference:
Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for PLA2G5 antibody (ARP41429)

Product page for PLA2G5 antibody (ARP41429)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Bovine PLA2G5 antibody; Bos taurus PLA2G5 antibody E1BEG8 85%
Dog PLA2G5 antibody; Canis familiaris PLA2G5 antibody E2RLW6 92%
Guinea pig LOC100728430 antibody; Cavia porcellus LOC100728430 antibody H0VLW6 85%
Horse LOC100058536 antibody; Equus caballus LOC100058536 antibody F7CGN3 84%
Human PA2G5 antibody; Homo sapiens PA2G5 antibody P39877 100%
Little brown bat PLA2G5 antibody; Myotis lucifugus PLA2G5 antibody G1PR44 85%
Lowland gorilla PLA2G5 antibody; Gorilla gorilla gorilla PLA2G5 antibody G3QVJ8 92%
Northern white-cheeked gibbon LOC100596670 antibody; Nomascus leucogenys LOC100596670 antibody G1R8T9 92%
Small-eared galago PLA2G5 antibody; Otolemur garnettii PLA2G5 antibody H0WKR6 78%
White-tufted-ear marmoset LOC100410471 antibody; Callithrix jacchus LOC100410471 antibody F7HE74 85%
White-tufted-ear marmoset LOC100410471 antibody; Callithrix jacchus LOC100410471 antibody F7HCI2 85%

Product Protocols: PLA2G5 antibody tested with Human Fetal Thymus Tissue (ARP41429_P050)

Aviva Systems Biology is the original manufacturer of this PLA2G5 antibody (ARP41429_P050)

Click here to view the PLA2G5 antibody Western Blot Protocol

Product Datasheet Link: PLA2G5 antibody (ARP41429_P050)

WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus

Western Blot image:

Description of Target: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PLA2G5 antibody (ARP41429_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question