website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PLA2G5 antibody - middle region (ARP41429_P050)

Description of Target:
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
Gene Symbol:
Official Gene Full Name:
Phospholipase A2, group V
NCBI Gene Id:
Alias Symbols:
DKFZp686C2294; GV-PLA2; MGC46205; PLA2-10; hVPLA(2); FRFB
Tissue Tool:
Find tissues and cell lines supported to express PLA2G5.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Calcium-dependent phospholipase A2
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PLA2G5 antibody - middle region (ARP41429_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%
Species Reactivity:
Human, Dog, Bovine, Rat, Guinea pig, Horse
Datasheets / Downloads:
Printable datasheet for
anti-PLA2G5 antibody
- ARP41429_P050
Peptide Sequence:
Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
Blocking Peptide:
For anti-PLA2G5 antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167)
Key Reference:
Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PLA2G5 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question