website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PLA2G5 antibody - middle region (ARP41429_P050)

  • Catalog#: ARP41429_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP41429_P050-FITC Conjugated

    ARP41429_P050-HRP Conjugated

    ARP41429_P050-Biotin Conjugated

    Gene Symbol:
    PLA2G5
    NCBI Gene Id:
    5322
    Official Gene Full Name:
    Phospholipase A2, group V
    Protein Name:
    Calcium-dependent phospholipase A2
    Swissprot Id:
    P39877
    Protein Accession #:
    NP_000920
    Nucleotide Accession #:
    NM_000929
    Alias Symbols:
    DKFZp686C2294, GV-PLA2, MGC46205, PLA2-10, hVPLA(2), FRFB
    Replacement Item:
    This antibody may replace item sc-18828 from Santa Cruz Biotechnology.
    Description of Target:
    This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
    Protein Size (# AA):
    138
    Molecular Weight:
    14kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PLA2G5.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PLA2G5.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human PLA2G5
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Rat: 86%
    Complete computational species homology data:
    Anti-PLA2G5 (ARP41429_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    PLA2G4A;
    Blocking Peptide:
    For anti-PLA2G5 (ARP41429_P050) antibody is Catalog # AAP41429 (Previous Catalog # AAPP24167)
    Datasheets / Downloads:
    Printable datasheet for anti-PLA2G5 (ARP41429_P050) antibody
    Target Reference:
    Wootton,P.T., (2007) Hum. Mol. Genet. 16 (12), 1437-1444

    Product Protocols: PLA2G5 antibody tested with Human Fetal Thymus Tissue (ARP41429_P050)

    Aviva Systems Biology is the original manufacturer of this PLA2G5 antibody (ARP41429_P050)

    Click here to view the PLA2G5 antibody Western Blot Protocol

    Product Datasheet Link: PLA2G5 antibody (ARP41429_P050)

    WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: Fetal Thymus

    Western Blot image:


    Description of Target: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s PLA2G5 antibody (ARP41429_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question