Catalog No: ARP42255_T100
Price: $0.00
SKU
ARP42255_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NAMPT (ARP42255_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH
Concentration1.0 mg/ml
Blocking PeptideFor anti-NAMPT (ARP42255_T100) antibody is Catalog # AAP42255 (Previous Catalog # AAPP24676)
ReferenceChen,M.P., (2006) J. Clin. Endocrinol. Metab. 91 (1), 295-299
Publications

Restoration of perivascular adipose tissue function in diet-induced obese mice without changing bodyweight. Br. J. Pharmacol. , (2017). 28055105

Gene SymbolNAMPT
Gene Full NameNicotinamide phosphoribosyltransferase
Alias SymbolsVF, PBEF, PBEF1, VISFATIN, 1110035O14Rik
NCBI Gene Id10135
Protein NameNicotinamide phosphoribosyltransferase
Description of TargetPBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.
Uniprot IDP43490
Protein Accession #NP_005737
Nucleotide Accession #NM_005746
Protein Size (# AA)491
Molecular Weight54kDa
Protein InteractionsUBC; NEDD8; NDRG1; CTSA; PEPD; MVD; GSR; ASS1; ANXA6; CD81; AKT2; ADORA2A; IFITM3; ND1; GGT1; FTL; CUL5; DDA1; GBAS; FANCA;
  1. What is the species homology for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PBEF1 Antibody - C-terminal region (ARP42255_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    This target may also be called "VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik" in publications.

  5. What is the shipping cost for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PBEF1 Antibody - C-terminal region (ARP42255_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NAMPT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NAMPT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NAMPT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NAMPT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NAMPT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NAMPT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PBEF1 Antibody - C-terminal region (ARP42255_T100)
Your Rating
We found other products you might like!