SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP53831_P050
Price: $0.00
SKU
ARP53831_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ODF2 (ARP53831_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ODF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ODF2 (ARP53831_P050) antibody is Catalog # AAP53831 (Previous Catalog # AAPP31123)
Gene SymbolODF2
Gene Full NameOuter dense fiber of sperm tails 2
Alias SymbolsCT134, ODF84, ODF2/1, ODF2/2
NCBI Gene Id4957
Protein NamecDNA FLJ56030, highly similar to Homo sapiens outer dense fiber of sperm tails 2 (ODF2), transcript variant 2, mRNA EMBL BAG63297.1
Description of TargetThe outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.
Uniprot IDB4DX85
Protein Accession #NP_702915
Nucleotide Accession #NM_153437
Protein Size (# AA)638
Molecular Weight70kDa
Protein InteractionsUBC; MARK4; FBXO25; BRCA1; APP; SP1; ELAVL1; SVIL; ODF1;
  1. What is the species homology for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ODF2 Antibody - N-terminal region (ARP53831_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    This target may also be called "CT134, ODF84, ODF2/1, ODF2/2" in publications.

  5. What is the shipping cost for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ODF2 Antibody - N-terminal region (ARP53831_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ODF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ODF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ODF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ODF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ODF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ODF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ODF2 Antibody - N-terminal region (ARP53831_P050)
Your Rating
We found other products you might like!