- Description of Target:
- MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
- Gene Symbol:
- MYL3
- Official Gene Full Name:
- Myosin, light chain 3, alkali; ventricular, skeletal, slow
- Alias Symbols:
- CMH8; MLC1V; VLC1; MLC1SB
- Tissue Tool:
- Find tissues and cell lines supported to express MYL3.
- Protein Accession# :
- NP_000249
- Nucleotide Accession#:
- NM_000258
- Swissprot Id:
- Q5R887
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 195
- Molecular Weight:
- 22kDa
- Application:
- WB
- Partner Proteins:
- OXSR1, STK39
- Immunogen:
- The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- MYL3 antibody - N-terminal region (ARP41381_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%; African clawed frog: 76%
- Datasheets / Downloads:
- Printable datasheet for
anti-MYL3 antibody
- ARP41381_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG
- Blocking Peptide:
- For anti-MYL3 antibody is Catalog # AAPP24119
- Key Reference:
- Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-MYL3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: MYL3 antibody tested with Human Colo205 Cells (ARP41381_P050)
Aviva Systems Biology is the original manufacturer of this MYL3 antibody (ARP41381_P050)
Click here to view the MYL3 antibody Western Blot Protocol
Product Datasheet Link: MYL3 antibody (ARP41381_P050)
WB Suggested Anti-MYL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205
Western Blot image: 
Description of Target: MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s MYL3 antibody (ARP41381_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
