LEP Antibody - N-terminal region (ARP41697_P050)

Catalog No: ARP41697_P050

WB Suggested Anti-LEP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Host: Rabbit
Target Name: LEP
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml

Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Placenta
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LEP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Goat: 91%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 91%
• Peptide Sequence: Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LEP (ARP41697_P050) antibody is Catalog # AAP41697 (Previous Catalog # AAPP24340)
• Reference: Souren,N.Y., (er) Int J Obes (Lond) (2008) In press
• Publications:

  Different expression of leptin and IGF1 in the adult and prepubertal testis in dogs. Reprod. Domest. Anim. 52 Suppl 2, 187-192 (2017). 28101891

  Leptin in the canine uterus and placenta: possible implications in pregnancy. Reprod Biol Endocrinol. 13, 13 (2015). 25871422

• Description:
  View product citations for LEP Antibody - N-terminal region (ARP41697_P050) on CiteAb

Target Info

• Gene Symbol: LEP
• Gene Full Name: leptin
• Alias Symbols: OB, OBS, LEPD
• NCBI Gene Id: 3952
• Protein Name: leptin
• Description of Target: This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
• Uniprot ID: P41159
• Protein Accession #: NP_000221
• Nucleotide Accession #: NM_000230
• Protein Size (# AA): 167
• Molecular Weight: 19kDa
• Protein Interactions: Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3;