IL18RAP Antibody - N-terminal region (ARP42154_T100)

Catalog No: ARP42154_T100

WB Suggested Anti-IL18RAP Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL18RAP
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-IL18RAP (ARP42154_T100) antibody is Catalog # AAP42154 (Previous Catalog # AAPP12566)
• Reference: Fukushima,K., (2005) J. Biol. Chem. 280 (18), 18056-18062

Target Info

• Gene Symbol: IL18RAP
• Gene Full Name: Interleukin 18 receptor accessory protein
• Alias Symbols: ACPL, CD218b, IL-1R7, IL18RB, CDw218b, IL-1R-7, IL-18RAcP, IL-1RAcPL, IL-18Rbeta, IL-18R-beta
• NCBI Gene Id: 8807
• Protein Name: Interleukin-18 receptor accessory protein
• Description of Target: IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.
• Uniprot ID: O95256
• Protein Accession #: NP_003844
• Nucleotide Accession #: NM_003853
• Protein Size (# AA): 599
• Molecular Weight: 66kDa
• Protein Interactions: APP; IL18; CD48;