Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP42231_T100
Price: $0.00
SKU
ARP42231_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HBZ (ARP42231_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HBZ
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Goat: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
Concentration1.0 mg/ml
Blocking PeptideFor anti-HBZ (ARP42231_T100) antibody is Catalog # AAP42231 (Previous Catalog # AAPP24654)
Sample Type Confirmation

HBZ is supported by BioGPS gene expression data to be expressed in K562

Subunitzeta
ReferenceHivin,P., J. Cell. Sci. 118 (PT 7), 1355-1362 (2005)
Gene SymbolHBZ
Gene Full NameHemoglobin, zeta
Alias SymbolsHBAZ, HBZ1, HBZ-T1
NCBI Gene Id3050
Protein NameHemoglobin subunit zeta
Description of TargetZeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5'-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3'.
Uniprot IDP02008
Protein Accession #NP_005323
Nucleotide Accession #NM_005332
Protein Size (# AA)142
Molecular Weight16kDa
Protein InteractionsNOTCH2NL; KRTAP10-3; KRTAP10-9; KRTAP10-7; KHDRBS2; KRT40; DOCK8; HBD; UPF2; HNRNPD; VCAM1; ITGA4; FN1; APP; SP1; JUND; IKBKG; HBZ; HBB; FGFR3;
  1. What is the species homology for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit".

  2. How long will it take to receive "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HBZ Antibody - N-terminal region (ARP42231_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    This target may also be called "HBAZ, HBZ1, HBZ-T1" in publications.

  5. What is the shipping cost for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HBZ Antibody - N-terminal region (ARP42231_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HBZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HBZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HBZ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HBZ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HBZ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HBZ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HBZ Antibody - N-terminal region (ARP42231_T100)
Your Rating
We found other products you might like!