website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

DDC antibody - middle region (ARP41426_P050)

Description of Target:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Gene Symbol:
Official Gene Full Name:
Dopa decarboxylase (aromatic L-amino acid decarboxylase)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express DDC.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Aromatic-L-amino-acid decarboxylase
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
DDC antibody - middle region (ARP41426_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 79%
Species Reactivity:
Human, Rat, Guinea pig, Mouse, Horse, Rabbit, Dog, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-DDC antibody
- ARP41426_P050
Peptide Sequence:
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Blocking Peptide:
For anti-DDC antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
Target Reference:
Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for DDC antibody (ARP41426)

Product page for DDC antibody (ARP41426)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant DDC antibody; Loxodonta africana DDC antibody G3UB43 100%
African elephant DDC antibody; Loxodonta africana DDC antibody G3TFB0 100%
Bovine DDC antibody; Bos taurus DDC antibody P27718 78%
Bovine DDC antibody; Bos taurus DDC antibody A5PJV5 78%
Dog DDC antibody; Canis familiaris DDC antibody F1PFV0 85%
Drosophila acutilabella amd antibody F4YFL4 84%
Drosophila angustibucca amd antibody Q3ZQJ1 76%
Drosophila angustibucca amd antibody Q3ZQJ0 76%
Drosophila cardinoides amd antibody Q3ZQI1 76%
Drosophila cardinoides Amd antibody D5FFZ8 76%
Drosophila dunni amd antibody F4YFL8 76%
Drosophila nappae Amd antibody D5FG19 76%
Drosophila nappae Amd antibody D5FG18 76%
Drosophila neocardini amd antibody Q3ZQH9 76%
Drosophila neocardini Amd antibody D5FG20 76%
Drosophila ornatipennis Amd antibody D5FG24 76%
Drosophila polymorpha Amd antibody D5FG30 76%
Drosophila procardinoides amd antibody F4YFL7 76%
Fruit fly amd antibody; Drosophila immigrans amd antibody Q964M2 76%
Fruit fly amd antibody; Drosophila immigrans amd antibody Q3ZQH8 76%
Fruit fly Amd antibody; Drosophila immigrans Amd antibody D5FG06 76%
Giant panda DDC antibody; Ailuropoda melanoleuca DDC antibody G1LN30 85%
Gray short-tailed opossum DDC antibody; Monodelphis domestica DDC antibody F7DVD1 92%
Gray short-tailed opossum DDC antibody; Monodelphis domestica DDC antibody F7DVC5 92%
Guinea pig DDC antibody; Cavia porcellus DDC antibody P22781 100%
Guinea pig DDC antibody; Cavia porcellus DDC antibody H0V599 100%
Guinea pig DDC antibody; Cavia porcellus DDC antibody H0V596 100%
Horse DDC antibody; Equus caballus DDC antibody F6ZPG5 92%
Human DCHS antibody; Homo sapiens DCHS antibody P19113 83%
Human DDC antibody; Homo sapiens DDC antibody P20711 100%
Human DDC antibody; Homo sapiens DDC antibody Q6IBS8 100%
Human DDC antibody; Homo sapiens DDC antibody Q53Y41 100%
Human DDC antibody; Homo sapiens DDC antibody E7EU95 100%
Human DDC antibody; Homo sapiens DDC antibody C9IYA0 100%
Human HDC antibody; Homo sapiens HDC antibody B7ZM01 83%
Lowland gorilla DDC antibody; Gorilla gorilla gorilla DDC antibody G3QTY2 100%
Lowland gorilla HDC antibody; Gorilla gorilla gorilla HDC antibody G3S6Z9 83%
Lowland gorilla HDC antibody; Gorilla gorilla gorilla HDC antibody G3QTF0 83%
Medaka fish ddc antibody; Oryzias latipes ddc antibody C0SQJ0 84%
Mouse DCHS antibody; Mus musculus DCHS antibody P23738 83%
Mouse DDC antibody; Mus musculus DDC antibody O88533 100%
Mouse Ddc antibody; Mus musculus Ddc antibody Q5SUV8 100%
Mouse Hdc antibody; Mus musculus Hdc antibody Q7TMW5 83%
Northern white-cheeked gibbon DDC antibody; Nomascus leucogenys DDC antibody G1RA43 100%
Northern white-cheeked gibbon HDC antibody; Nomascus leucogenys HDC antibody G1R2Y0 83%
Pig AADC antibody; Sus scrofa AADC antibody B5KFA1 78%
Pig AADC antibody; Sus scrofa AADC antibody B5KFA0 78%
Pig DDC antibody; Sus scrofa DDC antibody P80041 78%
Rabbit DDC antibody; Oryctolagus cuniculus DDC antibody G1T8G7 92%
Rat DDC antibody; Rattus norvegicus DDC antibody P14173 100%
Rat Ddc antibody; Rattus norvegicus Ddc antibody Q62819 100%
Rhesus macaque DDC antibody; Macaca mulatta DDC antibody F7FNW0 92%
Rhesus macaque HDC antibody; Macaca mulatta HDC antibody F7HFR2 83%
Rhesus macaque Mmu.3184 antibody; Macaca mulatta Mmu.3184 antibody F7FNW6 92%
Rhesus macaque Mmu.3184 antibody; Macaca mulatta Mmu.3184 antibody F7F442 92%
Tasmanian devil DDC antibody; Sarcophilus harrisii DDC antibody G3WV06 85%
Tetrahymena pyriformis HDC antibody O15787 83%
Three-spined stickleback DDC antibody; Gasterosteus aculeatus DDC antibody G3NT39 84%
White-tufted-ear marmoset DDC antibody; Callithrix jacchus DDC antibody F7HYG7 100%
White-tufted-ear marmoset DDC antibody; Callithrix jacchus DDC antibody F7G9U4 100%
White-tufted-ear marmoset DDC antibody; Callithrix jacchus DDC antibody F6RP74 100%
White-tufted-ear marmoset HDC antibody; Callithrix jacchus HDC antibody F7HZU2 83%
White-tufted-ear marmoset HDC antibody; Callithrix jacchus HDC antibody F7HZT5 83%

Product Protocols: DDC antibody tested with Human Fetal Spleen Tissue (ARP41426_P050)

Aviva Systems Biology is the original manufacturer of this DDC antibody (ARP41426_P050)

Click here to view the DDC antibody Western Blot Protocol

Product Datasheet Link: DDC antibody (ARP41426_P050)

WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:

Description of Target: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s DDC antibody (ARP41426_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question