website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DDC antibody - middle region (ARP41426_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP41426_P050-FITC Conjugated

ARP41426_P050-HRP Conjugated

ARP41426_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Dopa decarboxylase (aromatic L-amino acid decarboxylase)
Protein Name:
Aromatic-L-amino-acid decarboxylase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-293287 from Santa Cruz Biotechnology.
Description of Target:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDC.
The immunogen is a synthetic peptide directed towards the middle region of human DDC
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DDC (ARP41426_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DDC (ARP41426_P050) antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
Datasheets / Downloads:
Printable datasheet for anti-DDC (ARP41426_P050) antibody
Target Reference:
Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315

Product Protocols: DDC antibody tested with Human Fetal Spleen Tissue (ARP41426_P050)

Aviva Systems Biology is the original manufacturer of this DDC antibody (ARP41426_P050)

Click here to view the DDC antibody Western Blot Protocol

Product Datasheet Link: DDC antibody (ARP41426_P050)

WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:

Description of Target: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s DDC antibody (ARP41426_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...