website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

DDC antibody - middle region (ARP41426_P050)

Description of Target:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Gene Symbol:
DDC
Official Gene Full Name:
Dopa decarboxylase (aromatic L-amino acid decarboxylase)
NCBI Gene Id:
1644
Alias Symbols:
AADC
Tissue Tool:
Find tissues and cell lines supported to express DDC.
Protein Accession #:
NP_000781
Nucleotide Accession#:
NM_000790
Swissprot Id:
P20711
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Aromatic-L-amino-acid decarboxylase
Protein Size (# AA):
480
Molecular Weight:
54kDa
Application:
WB
Partner Proteins:
LYN
Immunogen:
The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
DDC antibody - middle region (ARP41426_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 79%
Species Reactivity:
Human, Rat, Guinea pig, Mouse, Horse, Rabbit, Dog, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-DDC antibody
- ARP41426_P050
Peptide Sequence:
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Blocking Peptide:
For anti-DDC antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
Key Reference:
Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-DDC antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question