website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

US

DDC antibody - middle region (ARP41426_P050)

  • Catalog#: ARP41426_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    DDC
    NCBI Gene Id:
    1644
    Official Gene Full Name:
    Dopa decarboxylase (aromatic L-amino acid decarboxylase)
    Protein Name:
    Aromatic-L-amino-acid decarboxylase
    Swissprot Id:
    P20711
    Protein Accession #:
    NP_000781
    Nucleotide Accession #:
    NM_000790
    Alias Symbols:
    AADC
    Description of Target:
    DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
    Protein Size (# AA):
    480
    Molecular Weight:
    54kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express DDC.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express DDC.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human DDC
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
    Complete computational species homology data:
    Anti-DDC (ARP41426_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    ATF6; RELA; AR;
    Blocking Peptide:
    For anti-DDC (ARP41426_P050) antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
    Datasheets / Downloads:
    Printable datasheet for anti-DDC (ARP41426_P050) antibody
    Target Reference:
    Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315

    Product Protocols: DDC antibody tested with Human Fetal Spleen Tissue (ARP41426_P050)

    Aviva Systems Biology is the original manufacturer of this DDC antibody (ARP41426_P050)

    Click here to view the DDC antibody Western Blot Protocol

    Product Datasheet Link: DDC antibody (ARP41426_P050)

    WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Fetal Spleen

    Western Blot image:


    Description of Target: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s DDC antibody (ARP41426_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question