website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

DDC antibody - middle region (ARP41426_P050)

Description of Target:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Gene Symbol:
DDC
Official Gene Full Name:
Dopa decarboxylase (aromatic L-amino acid decarboxylase)
NCBI Gene Id:
1644
Alias Symbols:
AADC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDC.
Swissprot Id:
P20711
Protein Accession #:
NP_000781
Nucleotide Accession #:
NM_000790
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Aromatic-L-amino-acid decarboxylase
Protein Size (# AA):
480
Molecular Weight:
54kDa
Application:
WB
Protein Interactions:
ATF6; RELA; AR;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-DDC (ARP41426_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-DDC (ARP41426_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Blocking Peptide:
For anti-DDC (ARP41426_P050) antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
Target Reference:
Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: DDC antibody tested with Human Fetal Spleen Tissue (ARP41426_P050)

Aviva Systems Biology is the original manufacturer of this DDC antibody (ARP41426_P050)

Click here to view the DDC antibody Western Blot Protocol

Product Datasheet Link: DDC antibody (ARP41426_P050)

WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:


Description of Target: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s DDC antibody (ARP41426_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question