- Description of Target:
- CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.
- Gene Symbol:
- CYP2E1
- Official Gene Full Name:
- Cytochrome P450, family 2, subfamily E, polypeptide 1
- Alias Symbols:
- CPE1; CYP2E; P450-J; P450C2E
- Tissue Tool:
- Find tissues and cell lines supported to express CYP2E1.
- Protein Accession# :
- NP_000764
- Nucleotide Accession#:
- NM_000773
- Swissprot Id:
- P05181
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 493
- Molecular Weight:
- 54kDa
- Application:
- WB
- Partner Proteins:
- AR
- Immunogen:
- The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CYP2E1 antibody - C-terminal region (ARP41424_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Guinea pig: 85%; Mouse: 85%; Rat: 85%; Bovine: 78%; Horse: 78%; Pig: 78%; Sheep: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-CYP2E1 antibody
- ARP41424_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
- Blocking Peptide:
- For anti-CYP2E1 antibody is Catalog # AAP41424 (Previous Catalog # AAPP24162)
- Key Reference:
- Dey,A., (2006) Arch. Biochem. Biophys. 447 (2), 155-166
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CYP2E1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CYP2E1 antibody tested with Human Fetal Liver Tissue (ARP41424_P050)
Aviva Systems Biology is the original manufacturer of this CYP2E1 antibody (ARP41424_P050)
Click here to view the CYP2E1 antibody Western Blot Protocol
Product Datasheet Link: CYP2E1 antibody (ARP41424_P050)
WB Suggested Anti-CYP2E1 Antibody Titration: 0.2-1 ug/ml
Positive Control: fetal liver
Western Blot image: 
Description of Target: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CYP2E1 antibody (ARP41424_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
