website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

CYP1A1 antibody - middle region (ARP41405_P050)

Description of Target:
CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
CYP1A1
Official Gene Full Name:
Cytochrome P450, family 1, subfamily A, polypeptide 1
Alias Symbols:
AHH; AHRR; CP11; CYP1; P1-450; P450-C; P450DX
Tissue Tool:
Find tissues and cell lines supported to express CYP1A1.
Protein Accession# :
NP_000490
Nucleotide Accession#:
NM_000499
Swissprot Id:
P04798
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
512
Molecular Weight:
58kDa
Application:
WB
Partner Proteins:
ACTN1, ASCC2, ATP5J2, BIN1, C14orf135, FBP1, FXR2, HSPA8, LNX1, RNF183, ASCC2, ATP5J2, C14orf135, FBP1, FXR2, HSPA8, LNX1, RNF183
Immunogen:
The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CYP1A1 antibody - middle region (ARP41405_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Bovine: 92%; Rat: 92%; Pig: 85%; Horse: 78%
Datasheets / Downloads:
Printable datasheet for
anti-CYP1A1 antibody
- ARP41405_P050
Peptide Sequence:
Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Blocking Peptide:
For anti-CYP1A1 antibody is Catalog # AAP41405 (Previous Catalog # AAPP24143)
Key Reference:
Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-CYP1A1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CYP1A1 antibody tested with Human Fetal Heart Tissue (ARP41405_P050)

Aviva Systems Biology is the original manufacturer of this CYP1A1 antibody (ARP41405_P050)

Click here to view the CYP1A1 antibody Western Blot Protocol

Product Datasheet Link: CYP1A1 antibody (ARP41405_P050)

WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Heart

Western Blot image:


Description of Target: CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CYP1A1 antibody (ARP41405_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: CYP1A1 antibody-middle region (ARP41405_P050) in Human and mouse lung microsome lysate using Western Blot

Product Page for CYP1A1 antibody-middle region (ARP41405_P050)

Researcher: Jing Peng, Fox Chase Cancer Center
Application: Western blotting
Species+tissue/cell type: Human and mouse lung microsome lysate
How many ug’s of tissue/cell lysate run on the gel:
1: Human lung microsome lysate
2: 150 ug mouse lung microsome lysate
3: 150 ug mouse lung microsome lysate
4: 150 ug mouse lung microsome lysate
5: 150 ug mouse lung microsome lysate
Primary antibody dilution: 1: 1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1: 10000

Questionnaire:

How do Aviva’s reagents play a role in your experimental goals?
We have data on gene expression at RNA levels and we would like to perform western blot to examine the protein levels. Therefore, we are testing those antibodies from Aviva for that goal.

How would you rate this antibody on a scale from 1-5 (5=best) and why?
3

Would you use this antibody in future experiments?
Yes

Have you used another antibody which has worked in your application?
No

Do you believe the information about the reagent on Aviva’s website is correct?
Yes

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes. If the ab works, we plan to use it in future experiments and will publish the data if the experiments work

How did you store the antibody after re-suspension?
10ul aliquots in -20oC

Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):
Isolated Microsome/Mouse Lung Tissue

How many different experimental trials were conducted using the antibody sample?
2

How was this sample prepared?
Microsome isolated from mouse lung tissue processed by mechanical homogenizer.

What controls were used in your experiment (positive/negative)?
Positive control : human lung microsome.

Please include your detailed WB Procedure/Protocol here:
Microsome isolated in KCL buffer + protease inhibitors
SDS PAGE: Used Bio-Rad ready gel 12%. Electrophoresis for 1 hr at 120V/.
Electroblotting 2hrs at 120 Volt/
Block membrane in 5% milk in TBS-T
Primary Antibody 1:1000 (diluted in 5%milk in TBS-T)
Incubated overnight in 4o C on a shaker
Secondary Antibody 1:10000 incubated for 1 hr RT on a shaker
Hose radish solution: ECL plus
Chemiluminescence. Protein simple FlourChemE