CTDSPL Antibody - N-terminal region (ARP42261_P050)

Catalog No: ARP42261_P050

Host: Rabbit
Target Name: CTDSPL
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Rabbit Anti-CTDSPL Antibody
Catalog Number: ARP42261
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTDSPL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 90%
• Peptide Sequence: Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CTDSPL (ARP42261_P050) antibody is Catalog # AAP42261 (Previous Catalog # AAPP24682)
• Sample Type Confirmation:

  CTDSPL is strongly supported by BioGPS gene expression data to be expressed in DLD1

• Reference: Kashuba,V.I., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (14), 4906-4911

Target Info

• Gene Symbol: CTDSPL
• Gene Full Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like
• Alias Symbols: PSR1, SCP3, HYA22, RBSP3, C3orf8
• NCBI Gene Id: 10217
• Protein Name: CTD small phosphatase-like protein
• Description of Target: CTDSPL may function as a phosphatase involved in the regulation of cell growth and differentiation.
• Uniprot ID: Q3ZTU0
• Protein Accession #: NP_005799
• Nucleotide Accession #: NM_005808
• Protein Size (# AA): 265
• Molecular Weight: 30kDa
• Protein Interactions: ced-5; ced-12; ELAVL1; UBC; CDK9; SNAI1;