CHST7 Antibody - middle region (ARP41615_T100)

Catalog No: ARP41615_T100

WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHST7
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CHST7 (ARP41615_T100) antibody is Catalog # AAP41615 (Previous Catalog # AAPS09707)
• Reference: Thiselton,D.L., (2002) Genomics 79 (4), 560-572

Target Info

• Gene Symbol: CHST7
• Gene Full Name: Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7
• Alias Symbols: GST-5, C6ST-2
• NCBI Gene Id: 56548
• Protein Name: Carbohydrate sulfotransferase 7
• Description of Target: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.
• Uniprot ID: Q9NS84
• Protein Accession #: NP_063939
• Nucleotide Accession #: NM_019886
• Protein Size (# AA): 486
• Molecular Weight: 53kDa
• Protein Interactions: UBC;