CDH16 Antibody - N-terminal region (ARP41541_P050)

Catalog No: ARP41541_P050

WB Suggested Anti-CDH16 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Host: Rabbit
Target: CDH16
Positive control (+): HepG2 (HG)
Negative control (-): Human stomach (ST)
Antibody concentration: 5ug/ml

Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-CDH16 antibody (ARP41541_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDH16
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDH16 (ARP41541_P050) antibody is Catalog # AAP41541 (Previous Catalog # AAPP24227)
• Reference: Thedieck,C., (2008) J. Mol. Biol. 378 (1), 145-153

Target Info

• Gene Symbol: CDH16
• Gene Full Name: Cadherin 16, KSP-cadherin
• Alias Symbols: -
• NCBI Gene Id: 1014
• Protein Name: Cadherin-16
• Description of Target: CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CDH3, CDH5, CDH8 and CDH11. The protein consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O75309
• Protein Accession #: NP_004053
• Nucleotide Accession #: NM_004062
• Protein Size (# AA): 829
• Molecular Weight: 90 kDa
• Protein Interactions: G6PC; CRYAB; CTNNB1;