CD40 Antibody - N-terminal region (ARP41929_P050)

Catalog No: ARP41929_P050

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-CD40 Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysateCD40 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD40
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD40 (ARP41929_P050) antibody is Catalog # AAP41929 (Previous Catalog # AAPP24466)
• Sample Type Confirmation:

  CD40 is strongly supported by BioGPS gene expression data to be expressed in Raji

• Reference: von (2006) Blood 107 (7), 2786-2789

Target Info

• Gene Symbol: CD40
• Gene Full Name: CD40 molecule, TNF receptor superfamily member 5
• Alias Symbols: p50, Bp50, CDW40, TNFRSF5
• NCBI Gene Id: 958
• Protein Name: Tumor necrosis factor receptor superfamily member 5
• Description of Target: CD40 is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
• Uniprot ID: P25942
• Protein Accession #: NP_001241
• Nucleotide Accession #: NM_001250
• Protein Size (# AA): 277
• Molecular Weight: 31 kDa
• Protein Interactions: TRAF2; TRAF3; PIK3R1; CD40LG; BAG3; Otud7b; Birc3; IL4R; TRAF6; TRAF5; TRAF3IP2; MAP3K8; TRAF4; TRAF1; PIK3CA; CBL; BIRC2; CDC40; TANK; HSPA4; NSMAF; XRCC5; HSPA8; TDP2; RIPK2; CAV1; JAK3; XRCC6; MS4A1; SUMO1; SLC30A7; RNF219; UGGT1; ERP44; NCOA6; USP15;