SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41928_P050
Price: $0.00
SKU
ARP41928_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CD40 (ARP41928_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CD40
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 91%; Horse: 83%; Human: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD40 (ARP41928_P050) antibody is Catalog # AAP41928 (Previous Catalog # AAPP24465)
ReferenceHsiao,J.Y., (er) Endocr. J. (2008) In press
Gene SymbolCD40
Gene Full NameCD40 molecule, TNF receptor superfamily member 5
Alias Symbolsp50, Bp50, CDW40, TNFRSF5
NCBI Gene Id958
Protein NameTumor necrosis factor receptor superfamily member 5
Description of TargetCD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Uniprot IDP25942
Protein Accession #NP_690593
Nucleotide Accession #NM_152854
Protein Size (# AA)203
Molecular Weight20kDa
Protein InteractionsTRAF2; TRAF3; PIK3R1; CD40LG; BAG3; Otud7b; Birc3; IL4R; TRAF6; TRAF5; TRAF3IP2; MAP3K8; TRAF4; TRAF1; PIK3CA; CBL; BIRC2; CDC40; TANK; HSPA4; NSMAF; XRCC5; HSPA8; TDP2; RIPK2; CAV1; JAK3; XRCC6; MS4A1; SUMO1; SLC30A7; RNF219; UGGT1; ERP44; NCOA6; USP15;
  1. What is the species homology for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD40 Antibody - N-terminal region (ARP41928_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    This target may also be called "p50, Bp50, CDW40, TNFRSF5" in publications.

  5. What is the shipping cost for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD40 Antibody - N-terminal region (ARP41928_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD40"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD40"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD40"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD40"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD40"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD40"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD40 Antibody - N-terminal region (ARP41928_P050)
Your Rating
We found other products you might like!