- Description of Target:
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
- Gene Symbol:
- CA4
- Official Gene Full Name:
- Carbonic anhydrase IV
- Alias Symbols:
- CAIV; Car4; RP17
- Tissue Tool:
- Find tissues and cell lines supported to express CA4.

- Protein Accession# :
- NP_000708
- Nucleotide Accession#:
- NM_000717
- Swissprot Id:
- P22748
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 312
- Molecular Weight:
- 34kDa
- Application:
- WB
- Partner Proteins:
- POR, FANCG, POR
- Immunogen:
- The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CA4 antibody - C-terminal region (ARP41422_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-CA4 antibody
- ARP41422_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
- Blocking Peptide:
- For anti-CA4 antibody is Catalog # AAP41422 (Previous Catalog # AAPP24160)
- Key Reference:
- Yang,Z., (2005) Hum. Mol. Genet. 14 (2), 255-265
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CA4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CA4 antibody tested with Human Fetal Lung Tissue (ARP41422_P050)
Aviva Systems Biology is the original manufacturer of this CA4 antibody (ARP41422_P050)
Click here to view the CA4 antibody Western Blot Protocol
Product Datasheet Link: CA4 antibody (ARP41422_P050)
WB Suggested Anti-CA4 Antibody Titration: 0.2-1 ug/ml
Positive Control: fetal lung
Western Blot image: 
Description of Target: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CA4 antibody (ARP41422_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


