APCS Antibody - N-terminal region (ARP41962_T100)

Catalog No: ARP41962_T100

WB Suggested Anti-APCS Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Rabbit Anti-APCS Antibody
Catalog Number: ARP41962
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103)
• Reference: Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005)

Target Info

• Gene Symbol: APCS
• Gene Full Name: Amyloid P component, serum
• Alias Symbols: SAP, PTX2, HEL-S-92n
• NCBI Gene Id: 325
• Protein Name: Serum amyloid P-component
• Description of Target: APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.
• Uniprot ID: P02743
• Protein Accession #: NP_001630
• Nucleotide Accession #: NM_001639
• Protein Size (# AA): 223
• Molecular Weight: 25kDa
• Protein Interactions: COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS;