Catalog No: ARP41894_P050
Price: $0.00
SKU
ARP41894_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALOX15B (ARP41894_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ALOX15B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 85%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALOX15B (ARP41894_P050) antibody is Catalog # AAP41894 (Previous Catalog # AAPP24431)
ReferenceSoon,P.S., (2008) Ann. Surg. 247 (1), 157-164
Gene SymbolALOX15B
Gene Full NameArachidonate 15-lipoxygenase, type B
Alias Symbols15-LOX-2
NCBI Gene Id247
Protein NameArachidonate 15-lipoxygenase B
Description of TargetALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.
Uniprot IDO15296
Protein Accession #NP_001034220
Nucleotide Accession #NM_001039131
Protein Size (# AA)602
Molecular Weight67kDa
Protein InteractionsRXRA; PPARG; ERAL1;
  1. What is the species homology for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit".

  2. How long will it take to receive "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALOX15B Antibody - N-terminal region (ARP41894_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    This target may also be called "15-LOX-2" in publications.

  5. What is the shipping cost for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALOX15B Antibody - N-terminal region (ARP41894_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALOX15B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALOX15B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALOX15B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALOX15B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALOX15B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALOX15B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALOX15B Antibody - N-terminal region (ARP41894_P050)
Your Rating
We found other products you might like!