ALAD Antibody - middle region (ARP41657_P050)

Catalog No: ARP41657_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ALAD Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateALAD is supported by BioGPS gene expression data to be expressed in Jurkat

Rabbit Anti-ALAD Antibody
Catalog Number: ARP41657_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALAD
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 86%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ALAD (ARP41657_P050) antibody is Catalog # AAP41657 (Previous Catalog # AAPP24301)
• Sample Type Confirmation:

  ALAD is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Tang,L., (2006) J. Biol. Chem. 281 (10), 6682-6690
• Publications:

  Iron metabolic pathways in the processes of sponge plasticity. PLoS One. 15, e0228722 (2020). 32084159

• Description:
  View product citations for ALAD Antibody - middle region (ARP41657_P050) on CiteAb

Target Info

• Gene Symbol: ALAD
• Gene Full Name: Aminolevulinate dehydratase
• Alias Symbols: PBGS, ALADH
• NCBI Gene Id: 210
• Protein Name: Delta-aminolevulinic acid dehydratase RuleBase RU000515
• Description of Target: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q6ZMU0
• Protein Accession #: NP_001003945
• Nucleotide Accession #: NM_001003945
• Protein Size (# AA): 359
• Molecular Weight: 39kDa
• Protein Interactions: C14orf142; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; OGT; SURF2; LPP; AGFG1; UBD; UBC; ALAD;