SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61430_P050
Price: $0.00
SKU
ARP61430_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP61430_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Pig: 92%; Rabbit: 86%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: PALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCT
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP61430
Sample Type Confirmation

AKR1C3 is supported by BioGPS gene expression data to be expressed in COLO205

Gene SymbolAKR1C3
Gene Full NameAldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Alias SymbolsDD3, DDX, PGFS, HAKRB, HAKRe, HA1753, HSD17B5, hluPGFS
NCBI Gene Id8644
Protein NameAldo-keto reductase family 1 member C3
Description of TargetThis gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Uniprot IDP42330
Protein Accession #NP_003730
Nucleotide Accession #NM_003739
Protein Size (# AA)323
Molecular Weight36kDa
Protein InteractionsUBC; LRIF1; ZHX1; UBE2W; ACIN1; MAGEA11;
  1. What is the species homology for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKR1C3 Antibody - N-terminal region (ARP61430_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    This target may also be called "DD3, DDX, PGFS, HAKRB, HAKRe, HA1753, HSD17B5, hluPGFS" in publications.

  5. What is the shipping cost for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKR1C3 Antibody - N-terminal region (ARP61430_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKR1C3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKR1C3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKR1C3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKR1C3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKR1C3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKR1C3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKR1C3 Antibody - N-terminal region (ARP61430_P050)
Your Rating
We found other products you might like!