ZNF322A Antibody - C-terminal region (ARP39605_P050)

Catalog No: ARP39605_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate

Human Stomach

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF322A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Goat: 92%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 92%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF322 (ARP39605_P050) antibody is Catalog # AAP39605 (Previous Catalog # AAPP21625)
• Reference: Li,Y., (2004) Biochem. Biophys. Res. Commun. 325 (4), 1383-1392

Target Info

• Gene Symbol: ZNF322
• Gene Full Name: Zinc finger protein 322
• Alias Symbols: HCG12, ZNF388, ZNF489, ZNF322A
• NCBI Gene Id: 79692
• Protein Name: Zinc finger protein 322
• Description of Target: ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.
• Uniprot ID: Q6U7Q0
• Protein Accession #: NP_078915
• Nucleotide Accession #: NM_024639
• Protein Size (# AA): 402
• Molecular Weight: 47kDa
• Protein Interactions: APP;