TPH2 Antibody - middle region (ARP34140_P050)

Catalog No: ARP34140_P050

WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:500
Positive Control: Human brain

Host: Rabbit
Target Name: TPH2
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPH2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TPH2 (ARP34140_P050) antibody is Catalog # AAP34140 (Previous Catalog # AAPP05402)
• Reference: Tzvetkov,M.V., (2008) Pharmacogenet. Genomics 18 (6), 495-506

Target Info

• Gene Symbol: TPH2
• Gene Full Name: Tryptophan hydroxylase 2
• Alias Symbols: NTPH, ADHD7
• NCBI Gene Id: 121278
• Protein Name: Tryptophan 5-hydroxylase 2
• Description of Target: Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility. This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. The human genome contains two related tryptophan hydroxylases, one on chromosome 11p15-p14 and one on chromosome 12q21. This gene is expressed predominantly in the brain stem. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by the mouse ortholog. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1805 AY098914.1 1-1805 1806-2360 AC090109.15 122981-123535
• Uniprot ID: Q8IWU9
• Protein Accession #: NP_775489
• Nucleotide Accession #: NM_173353
• Protein Size (# AA): 490
• Molecular Weight: 56kDa
• Protein Interactions: UBC;