TEF Antibody - middle region (ARP33430_P050)

Catalog No: ARP33430_P050

WB Suggested Anti-TEF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEF
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 92%; Sheep: 92%
• Peptide Sequence: Synthetic peptide located within the following region: RKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TEF (ARP33430_P050) antibody is Catalog # AAP33430 (Previous Catalog # AAPP04476)
• Reference: Inukai,T., (2005) Blood 105 (11), 4437-4444

Target Info

• Gene Symbol: TEF
• Gene Full Name: Thyrotrophic embryonic factor
• Alias Symbols: -
• NCBI Gene Id: 7008
• Protein Name: Thyrotroph embryonic factor
• Description of Target: TEF (thyrotroph embryonic factor) is a member of the PAR bZip (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It accumulates with robust circadian rhythms in tissues with high amplitudes of clock gene expression. Thyrotroph embryonic factor (TEF), a transcription factor, is a member of the PAR (proline and acidic amino acid-rich) subfamily of basic region/leucine zipper (bZIP) transcription factors. It is expressed in a broad range of cells and tissues in adult animals, however, during embryonic development, TEF expression appears to be restricted to the developing anterior pituitary gland, coincident with the appearance of thyroid-stimulating hormone, beta (TSHB). Indeed, TEF can bind to, and transactivate the TSHB promoter. It shows homology (in the functional domains) with other members of the PAR-bZIP subfamily of transcription factors, which include albumin D box-binding protein (DBP), human hepatic leukemia factor (HLF) and chicken vitellogenin gene-binding protein (VBP); VBP is considered the chicken homologue of TEF. Different members of the subfamily can readily form heterodimers, and share DNA-binding, and transcriptional regulatory properties.
• Uniprot ID: Q10587
• Protein Accession #: NP_003207
• Nucleotide Accession #: NM_003216
• Protein Size (# AA): 303
• Molecular Weight: 33kDa
• Protein Interactions: MRPL28; DBP;