website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

SOX30 antibody - middle region (ARP32227_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.
Gene Symbol:
Official Gene Full Name:
SRY (sex determining region Y)-box 30
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX30.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Transcription factor SOX-30
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-SOX30 antibody: synthetic peptide directed towards the middle region of human SOX30
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
SOX30 antibody - middle region (ARP32227_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Bovine, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-SOX30 antibody
- ARP32227_P050
Peptide Sequence:
Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR
Blocking Peptide:
For anti-SOX30 antibody is Catalog # AAP32227 (Previous Catalog # AAPP03208)
Target Reference:
Osaki,E., et al., (1999) Acids Res. 27 (12), 2503-2510
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SOX30 antibody tested with Human Hepg2 Cells (ARP32227_P050)

Aviva Systems Biology is the original manufacturer of this SOX30 antibody (ARP32227_P050)

Click here to view the SOX30 antibody Western Blot Protocol

Product Datasheet Link: SOX30 antibody (ARP32227_P050)

WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SOX30 antibody (ARP32227_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question