website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

SOX30 antibody - middle region (ARP32227_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    SRY (sex determining region Y)-box 30
    Protein Name:
    Transcription factor SOX-30
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Description of Target:
    The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express SOX30.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express SOX30.
    The immunogen is a synthetic peptide directed towards the middle region of human SOX30
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
    Complete computational species homology data:
    Anti-SOX30 (ARP32227_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    C6orf165; AHCYL1; FLI1; GNAI3; FBXO38; DDX56; DCAF4; CUL5; NME1; KIFC3; GP2; PAXIP1; BRCA1; NUDT3; BAMBI; TRAF2;
    Blocking Peptide:
    For anti-SOX30 (ARP32227_P050) antibody is Catalog # AAP32227 (Previous Catalog # AAPP03208)
    Datasheets / Downloads:
    Printable datasheet for anti-SOX30 (ARP32227_P050) antibody
    Target Reference:
    Osaki,E., et al., (1999) Acids Res. 27 (12), 2503-2510

    Product Protocols: SOX30 antibody tested with Human Hepg2 Cells (ARP32227_P050)

    Aviva Systems Biology is the original manufacturer of this SOX30 antibody (ARP32227_P050)

    Click here to view the SOX30 antibody Western Blot Protocol

    Product Datasheet Link: SOX30 antibody (ARP32227_P050)

    WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: HepG2

    Western Blot image:

    Description of Target: The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s SOX30 antibody (ARP32227_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question