website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SOX30 antibody - middle region (ARP32227_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.
Gene Symbol:
Official Gene Full Name:
SRY (sex determining region Y)-box 30
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express SOX30.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transcription factor SOX-30
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-SOX30 antibody: synthetic peptide directed towards the middle region of human SOX30
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
SOX30 antibody - middle region (ARP32227_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Bovine, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-SOX30 antibody
- ARP32227_P050
Peptide Sequence:
Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR
Blocking Peptide:
For anti-SOX30 antibody is Catalog # AAP32227 (Previous Catalog # AAPP03208)
Target Reference:
Osaki,E., et al., (1999) Acids Res. 27 (12), 2503-2510
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for SOX30 antibody (ARP32227)

Product page for SOX30 antibody (ARP32227)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SOX30 antibody; Loxodonta africana SOX30 antibody G3SV69 100%
Bovine SOX30 antibody; Bos taurus SOX30 antibody Q29RR8 100%
Chicken SOX30 antibody; Gallus gallus SOX30 antibody E1BQW7 85%
Common pipistrelle sox30 antibody; Pipistrellus pipistrellus sox30 antibody Q8WMM8 100%
Common turkey SOX30 antibody; Meleagris gallopavo SOX30 antibody G1N0D0 85%
Crab-eating macaque SOX30 antibody; Macaca fascicularis SOX30 antibody Q8WNV5 100%
Dog SOX30 antibody; Canis familiaris SOX30 antibody F1PVV2 100%
Dog SOX30 antibody; Canis familiaris SOX30 antibody E2QWF3 100%
Giant panda SOX30 antibody; Ailuropoda melanoleuca SOX30 antibody G1LIC7 100%
Gray short-tailed opossum SOX30 antibody; Monodelphis domestica SOX30 antibody F7EKS5 100%
Greater horseshoe bat sox30 antibody; Rhinolophus ferrumequinum sox30 antibody Q8WMM6 100%
Guinea pig SOX30 antibody; Cavia porcellus SOX30 antibody H0UTU4 100%
Horse SOX30 antibody; Equus caballus SOX30 antibody Q95M81 100%
Horse SOX30 antibody; Equus caballus SOX30 antibody F6X1G2 100%
Human SOX30 antibody; Homo sapiens SOX30 antibody O94993 100%
Human SOX30 antibody; Homo sapiens SOX30 antibody O94993-2 100%
Human SOX30 antibody; Homo sapiens SOX30 antibody B4DXW7 100%
Little brown bat SOX30 antibody; Myotis lucifugus SOX30 antibody G1PTE8 100%
Lowland gorilla SOX30 antibody; Gorilla gorilla gorilla SOX30 antibody G3SJ73 100%
Lowland gorilla SOX30 antibody; Gorilla gorilla gorilla SOX30 antibody G3SHX0 100%
Mouse SOX30 antibody; Mus musculus SOX30 antibody Q8CGW4 100%
Mouse Sox30 antibody; Mus musculus Sox30 antibody Q5SUH8 100%
Northern white-cheeked gibbon LOC100601617 antibody; Nomascus leucogenys LOC100601617 antibody G1QVQ5 100%
Pig SOX30 antibody; Sus scrofa SOX30 antibody F1RQF2 100%
Rabbit SOX30 antibody; Oryctolagus cuniculus SOX30 antibody G1T885 100%
Rat Sox30 antibody; Rattus norvegicus Sox30 antibody F1M453 100%
Rhesus macaque SOX30 antibody; Macaca mulatta SOX30 antibody F7FAC7 100%
Rhesus macaque SOX30 antibody; Macaca mulatta SOX30 antibody F7FAB6 100%
Small-eared galago SOX30 antibody; Otolemur garnettii SOX30 antibody H0WZT2 100%
Tasmanian devil SOX30 antibody; Sarcophilus harrisii SOX30 antibody G3WWD3 100%
Transparent sea squirt CI-SOXH antibody; Ciona intestinalis CI-SOXH antibody F6UEB6 76%
Transparent sea squirt soxh antibody; Ciona intestinalis soxh antibody Q4H2R7 76%
White-tufted-ear marmoset SOX30 antibody; Callithrix jacchus SOX30 antibody F7IMZ0 100%
White-tufted-ear marmoset SOX30 antibody; Callithrix jacchus SOX30 antibody F7IMY9 100%
White-tufted-ear marmoset SOX30 antibody; Callithrix jacchus SOX30 antibody F7ILL7 100%
White-tufted-ear marmoset SOX30 antibody; Callithrix jacchus SOX30 antibody F7IKN8 100%
Zebra finch SOX30 antibody; Taeniopygia guttata SOX30 antibody H0YQS3 78%

Product Protocols: SOX30 antibody tested with Human Hepg2 Cells (ARP32227_P050)

Aviva Systems Biology is the original manufacturer of this SOX30 antibody (ARP32227_P050)

Click here to view the SOX30 antibody Western Blot Protocol

Product Datasheet Link: SOX30 antibody (ARP32227_P050)

WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SOX30 antibody (ARP32227_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question