website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SOX30 antibody - middle region (ARP32227_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells.
Gene Symbol:
SOX30
Official Gene Full Name:
SRY (sex determining region Y)-box 30
NCBI Gene Id:
11063
Alias Symbols:
-
Tissue Tool:
Find tissues and cell lines supported to express SOX30.
Protein Accession #:
NP_848511
Nucleotide Accession#:
NM_178424
Swissprot Id:
O94993
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Transcription factor SOX-30
Protein Size (# AA):
753
Molecular Weight:
82kDa
Application:
WB
Immunogen:
The immunogen for anti-SOX30 antibody: synthetic peptide directed towards the middle region of human SOX30
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SOX30 antibody - middle region (ARP32227_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Bovine, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-SOX30 antibody
- ARP32227_P050
Peptide Sequence:
Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR
Blocking Peptide:
For anti-SOX30 antibody is Catalog # AAP32227 (Previous Catalog # AAPP03208)
Key Reference:
Osaki,E., et al., (1999) Acids Res. 27 (12), 2503-2510
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SOX30 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question