NHEJ1 Antibody - C-terminal region (ARP61619_P050)

Catalog No: ARP61619_P050

WB Suggested Anti-NHEJ1 Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole CellNHEJ1 is supported by BioGPS gene expression data to be expressed in ACHN

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Human: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: IDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NHEJ1 (ARP61619_P050) antibody is Catalog # AAP61619 (Previous Catalog # AAPP47720)
• Sample Type Confirmation:

  NHEJ1 is supported by BioGPS gene expression data to be expressed in ACHN

Target Info

• Gene Symbol: NHEJ1
• Gene Full Name: Nonhomologous end-joining factor 1
• Alias Symbols: XLF
• NCBI Gene Id: 79840
• Protein Name: Non-homologous end-joining factor 1
• Description of Target: Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders.
• Uniprot ID: Q9H9Q4
• Protein Accession #: NP_079058
• Nucleotide Accession #: NM_024782
• Protein Size (# AA): 299
• Molecular Weight: 33kDa
• Protein Interactions: UBC; NAA20; XRCC4; NHEJ1; LIG4;