website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

HOXA7 antibody - N-terminal region (ARP32637_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Gene Symbol:
Official Gene Full Name:
Homeobox A7
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express HOXA7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Homeobox protein Hox-A7
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
HOXA7 antibody - N-terminal region (ARP32637_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Pig, Horse, Rabbit, Bovine, Dog, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-HOXA7 antibody
- ARP32637_P050
Peptide Sequence:
Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
Blocking Peptide:
For anti-HOXA7 antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
Key Reference:
Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HOXA7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question