website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

HOXA7 antibody - N-terminal region (ARP32637_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Gene Symbol:
Official Gene Full Name:
Homeobox A7
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express HOXA7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Homeobox protein Hox-A7
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
HOXA7 antibody - N-terminal region (ARP32637_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Pig, Horse, Rabbit, Bovine, Dog, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-HOXA7 antibody
- ARP32637_P050
Peptide Sequence:
Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
Blocking Peptide:
For anti-HOXA7 antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
Target Reference:
Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HOXA7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for HOXA7 antibody (ARP32637)

Product page for HOXA7 antibody (ARP32637)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog hoxa7 antibody; Xenopus laevis hoxa7 antibody B7ZRU4 92%
African clawed frog HXA7 antibody; Xenopus laevis HXA7 antibody P09071 92%
African elephant HOXA7 antibody; Loxodonta africana HOXA7 antibody G3SPU1 100%
Bovine HOXA7 antibody; Bos taurus HOXA7 antibody E1B8D8 100%
Chicken HXA7 antibody; Gallus gallus HXA7 antibody Q90VZ9 100%
Chimpanzee HXA7 antibody; Pan troglodytes HXA7 antibody A2T7F3 100%
Chinese softshell turtle Hoxa-7 antibody; Pelodiscus sinensis Hoxa-7 antibody Q588G3 92%
Common turkey HOXA3 antibody; Meleagris gallopavo HOXA3 antibody G1NE02 100%
Common woolly monkey HOXA7 antibody; Lagothrix lagotricha HOXA7 antibody A2D5X0 100%
Dog HOXA7 antibody; Canis familiaris HOXA7 antibody E2R5U1 100%
Duckbill platypus HOXA7 antibody; Ornithorhynchus anatinus HOXA7 antibody F7EBX1 100%
Duckbill platypus HOXA7 antibody; Ornithorhynchus anatinus HOXA7 antibody F7EBW7 100%
Dusky titi monkey HOXA7 antibody; Callicebus moloch HOXA7 antibody B1MTZ1 100%
Elephant fish HoxA7 antibody; Callorhynchus milii HoxA7 antibody C7B9C6 78%
Elephant fish HoxB7 antibody; Callorhynchus milii HoxB7 antibody C7B9D9 85%
Eurasian common shrew HOXA5 antibody; Sorex araneus HOXA5 antibody B3RFG3 100%
Giant panda HOXA7 antibody; Ailuropoda melanoleuca HOXA7 antibody G1LH14 100%
Greater horseshoe bat HOXA7 antibody; Rhinolophus ferrumequinum HOXA7 antibody B2KIM9 100%
Horn shark HXA7 antibody; Heterodontus francisci HXA7 antibody Q9IA25 78%
Horse LOC100054532 antibody; Equus caballus LOC100054532 antibody F7ASR3 100%
Human HOXA7 antibody; Homo sapiens HOXA7 antibody E5RHM9 100%
Human HXA7 antibody; Homo sapiens HXA7 antibody P31268 100%
Japanese quail HXA7 antibody; Coturnix coturnix japonica HXA7 antibody P24061 100%
Little brown bat HOXA7 antibody; Myotis lucifugus HOXA7 antibody G1PB52 100%
Little skate Hoxa7 antibody; Leucoraja erinacea Hoxa7 antibody C8YZ57 78%
Lowland gorilla HOXA7 antibody; Gorilla gorilla gorilla HOXA7 antibody G3QIH6 100%
Mouse HXA7 antibody; Mus musculus HXA7 antibody P02830 100%
Northern white-cheeked gibbon HOXA6 antibody; Nomascus leucogenys HOXA6 antibody G1RY97 100%
Olive baboon HOXA7 antibody; Papio anubis HOXA7 antibody A9L941 100%
Pig LOC100519456 antibody; Sus scrofa LOC100519456 antibody F1SHT4 100%
Pig-tailed macaque HOXA7 antibody; Macaca nemestrina HOXA7 antibody A2T6V7 100%
Pygmy chimpanzee HXA7 antibody; Pan paniscus HXA7 antibody A1YGK7 100%
Rabbit HOXA7 antibody; Oryctolagus cuniculus HOXA7 antibody B7NZT6 100%
Rat Hoxa9 antibody; Rattus norvegicus Hoxa9 antibody F1LMS8 100%
Red-chested mustached tamarin HOXA7 antibody; Saguinus labiatus HOXA7 antibody A1YFW1 100%
Rhesus macaque HOXA7 antibody; Macaca mulatta HOXA7 antibody F6YGS3 100%
Rhesus macaque HOXA7 antibody; Macaca mulatta HOXA7 antibody A2D6D8 100%
Ring-tailed lemur HOXA7 antibody; Lemur catta HOXA7 antibody A2D615 100%
Small-eared galago HOXA7 antibody; Otolemur garnettii HOXA7 antibody B5SNP3 100%
Tammar wallaby HOXA7 antibody; Macropus eugenii HOXA7 antibody G9HPQ0 100%
Tasmanian devil HOXA7 antibody; Sarcophilus harrisii HOXA7 antibody G3WW52 100%
Western clawed frog hoxa7 antibody; Xenopus tropicalis hoxa7 antibody F7D5P6 100%
White-tufted-ear marmoset HOXA7 antibody; Callithrix jacchus HOXA7 antibody B0VXK7 100%
Zebra finch LOC100231229 antibody; Taeniopygia guttata LOC100231229 antibody H0YXH8 100%

Product Protocols: HOXA7 antibody tested with Human Jurkat Cells (ARP32637_P050)

Aviva Systems Biology is the original manufacturer of this HOXA7 antibody (ARP32637_P050)

Click here to view the HOXA7 antibody Western Blot Protocol

Product Datasheet Link: HOXA7 antibody (ARP32637_P050)

WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s HOXA7 antibody (ARP32637_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question