website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

HOXA7 antibody - N-terminal region (ARP32637_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Gene Symbol:
HOXA7
Official Gene Full Name:
Homeobox A7
NCBI Gene Id:
3204
Alias Symbols:
ANTP; HOX1; HOX1A; HOX1.1
Sample Type Confirmation:

HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express HOXA7.
Protein Accession #:
NP_008827
Nucleotide Accession#:
NM_006896
Swissprot Id:
P31268
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Homeobox protein Hox-A7
Protein Size (# AA):
230
Molecular Weight:
25kDa
Application:
WB
Protein Interactions:
PEX5; NPM1; JUNB; UBC; GMNN; MEIS1;
Immunogen:
The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
HOXA7 antibody - N-terminal region (ARP32637_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Species Reactivity:
Pig, Horse, Rabbit, Bovine, Dog, Human, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-HOXA7 antibody
- ARP32637_P050
Peptide Sequence:
Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
Blocking Peptide:
For anti-HOXA7 antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
Target Reference:
Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: HOXA7 antibody tested with Human Jurkat Cells (ARP32637_P050)

Aviva Systems Biology is the original manufacturer of this HOXA7 antibody (ARP32637_P050)

Click here to view the HOXA7 antibody Western Blot Protocol

Product Datasheet Link: HOXA7 antibody (ARP32637_P050)

WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HOXA7 antibody (ARP32637_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question