website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HOXA7 antibody - N-terminal region (ARP32637_P050)

  • Catalog#: ARP32637_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP32637_P050-FITC Conjugated

    ARP32637_P050-HRP Conjugated

    ARP32637_P050-Biotin Conjugated

    Gene Symbol:
    HOXA7
    NCBI Gene Id:
    3204
    Official Gene Full Name:
    Homeobox A7
    Protein Name:
    Homeobox protein Hox-A7
    Swissprot Id:
    P31268
    Protein Accession #:
    NP_008827
    Nucleotide Accession #:
    NM_006896
    Alias Symbols:
    ANTP, HOX1, HOX1A, HOX1.1
    Replacement Item:
    This antibody may replace item sc-17152 from Santa Cruz Biotechnology.
    Description of Target:
    In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
    Protein Size (# AA):
    230
    Molecular Weight:
    25kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express HOXA7.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express HOXA7.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA7
    Species Reactivity:
    Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-HOXA7 (ARP32637_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    PEX5; NPM1; JUNB; UBC; GMNN; MEIS1;
    Blocking Peptide:
    For anti-HOXA7 (ARP32637_P050) antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
    Datasheets / Downloads:
    Printable datasheet for anti-HOXA7 (ARP32637_P050) antibody
    Sample Type Confirmation:

    HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

    Target Reference:
    Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688

    Product Protocols: HOXA7 antibody tested with Human Jurkat Cells (ARP32637_P050)

    Aviva Systems Biology is the original manufacturer of this HOXA7 antibody (ARP32637_P050)

    Click here to view the HOXA7 antibody Western Blot Protocol

    Product Datasheet Link: HOXA7 antibody (ARP32637_P050)

    WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml
    Positive Control: Jurkat

    Western Blot image:


    Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s HOXA7 antibody (ARP32637_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question