website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - Monday 9/1/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

GATA2 antibody - N-terminal region (ARP31855_T100)

Description of Target:
The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Gene Symbol:
GATA2
Official Gene Full Name:
GATA binding protein 2
NCBI Gene Id:
2624
Alias Symbols:
DCML; NFE1B; MONOMAC
Sample Type Confirmation:

GATA2 is strongly supported by BioGPS gene expression data to be expressed in K562

Tissue Tool:
Find tissues and cell lines supported to express GATA2.
Protein Accession #:
NP_116027
Nucleotide Accession#:
NM_032638
Swissprot Id:
P23769
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Endothelial transcription factor GATA-2
Protein Size (# AA):
480
Molecular Weight:
50kDa
Application:
IHC, WB
Partner Proteins:
NKX2-8
Immunogen:
The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GATA2 antibody - N-terminal region (ARP31855_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GATA2 antibody
- ARP31855_T100
Peptide Sequence:
Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Blocking Peptide:
For anti-GATA2 antibody is Catalog # AAP31855 (Previous Catalog # AAPP02650)
Target Reference:
Tsuzuki, S., et al., (2004) Mol. Cell. Biol. 24 (15), 6824-6836
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GATA2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Publications:

Anti-GATA2 ARP31855_T100 has recently been referenced in the following publications:

Wang, F. et al. A regulatory circuit comprising GATA1/2 switch and microRNA-27a/24 promotes erythropoiesis. Nucleic Acids Res. 42, 442–57 (2014). WB, IHC, IP, EMSA, ChIP, Human, Rat 24049083

Fujiwara, T. et al. Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells. PLoS One 7, e40959 (2012). WB, IHC, IP, EMSA, ChIP, Human, Rat 23028422

Jack, B. H. A. & Crossley, M. GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis. J. Biol. Chem. 285, 32405–14 (2010). WB, IHC, IP, EMSA, ChIP, Human, Rat 20705609

Huang, Y.-J. et al. The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer. Mutat. Res. 702, 32–9 (2010). WB, IHC, IP, EMSA, ChIP, Human, Rat 20599521

Mammoto, A. et al. A mechanosensitive transcriptional mechanism that controls angiogenesis. Nature 457, 1103–8 (2009). WB, IHC, IP, EMSA, ChIP, Human, Rat 19242469

Computational species homology for GATA2 antibody (ARP31855)

Product page for GATA2 antibody (ARP31855)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog GATA2 antibody; Xenopus laevis GATA2 antibody P23770 92%
African clawed frog gata2 antibody; Xenopus laevis gata2 antibody Q32NN9 92%
African elephant GATA2 antibody; Loxodonta africana GATA2 antibody G3U9D0 100%
African elephant GATA2 antibody; Loxodonta africana GATA2 antibody G3U3A4 100%
Bovine GATA2 antibody; Bos taurus GATA2 antibody E1BAM5 100%
Chicken GATA2 antibody; Gallus gallus GATA2 antibody P23824 92%
Chicken GATA2 antibody; Gallus gallus GATA2 antibody E1BWV2 90%
Chicken GATA2 antibody; Gallus gallus GATA2 antibody G1K304 85%
Chinese hamster Gata2 antibody; Cricetulus griseus Gata2 antibody G3HIC9 100%
Common turkey LOC100550201 antibody; Meleagris gallopavo LOC100550201 antibody G1N5I0 92%
Dog GATA2 antibody; Canis familiaris GATA2 antibody E2RQ60 100%
Giant panda GATA2 antibody; Ailuropoda melanoleuca GATA2 antibody D2H7C2 100%
Gray short-tailed opossum LOC100017255 antibody; Monodelphis domestica LOC100017255 antibody F6ZA02 92%
Green anole GATA2 antibody; Anolis carolinensis GATA2 antibody G1KEP1 80%
Guinea pig GATA2 antibody; Cavia porcellus GATA2 antibody H0VFF7 100%
Horse GATA2 antibody; Equus caballus GATA2 antibody F6XH29 100%
Human GATA2 antibody; Homo sapiens GATA2 antibody P23769 100%
Human GATA2 antibody; Homo sapiens GATA2 antibody P23769-2 100%
Human GATA2 antibody; Homo sapiens GATA2 antibody C9J965 100%
Little brown bat GATA2 antibody; Myotis lucifugus GATA2 antibody G1P4X3 100%
Lowland gorilla GATA2 antibody; Gorilla gorilla gorilla GATA2 antibody G3QTJ7 100%
Mouse GATA2 antibody; Mus musculus GATA2 antibody O09100 100%
Mouse Gata2 antibody; Mus musculus Gata2 antibody Q9DC59 100%
Mouse Gata2 antibody; Mus musculus Gata2 antibody Q9DBY9 100%
Mouse Gata2 antibody; Mus musculus Gata2 antibody Q3U320 100%
Mouse Gata2 antibody; Mus musculus Gata2 antibody Q3B845 100%
Northern white-cheeked gibbon GATA2 antibody; Nomascus leucogenys GATA2 antibody G1RVX7 100%
Pig GATA2 antibody; Sus scrofa GATA2 antibody Q865U9 100%
Pig GATA2 antibody; Sus scrofa GATA2 antibody Q6WL03 100%
Rabbit LOC100008832 antibody; Oryctolagus cuniculus LOC100008832 antibody G1SUL8 100%
Rat GATA2 antibody; Rattus norvegicus GATA2 antibody Q924Y4 100%
Rat Gata2 antibody; Rattus norvegicus Gata2 antibody B2DBE1 100%
Rhesus macaque GATA2 antibody; Macaca mulatta GATA2 antibody F7FID3 100%
Rhesus macaque GATA2 antibody; Macaca mulatta GATA2 antibody F6VIP3 100%
Small-eared galago GATA2 antibody; Otolemur garnettii GATA2 antibody H0X9A6 100%
Tasmanian devil GATA2 antibody; Sarcophilus harrisii GATA2 antibody G3WUA0 92%
Western clawed frog LOC100487142 antibody; Xenopus tropicalis LOC100487142 antibody F6UN64 91%
White-tufted-ear marmoset GATA2 antibody; Callithrix jacchus GATA2 antibody F7HXJ7 100%

Product Protocols: GATA2 antibody tested with Human K562 Cells (ARP31855_T100)

Aviva Systems Biology is the original manufacturer of this GATA2 antibody (ARP31855_T100)

Click here to view the GATA2 antibody Western Blot Protocol

Product Datasheet Link: GATA2 antibody (ARP31855_T100)

WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0ug/ml
ELISA Titer: 1:1562500
Positive Control: k562

Western Blot image:


Description of Target: The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GATA2 antibody (ARP31855_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: GATA2 antibody tested by IHC with human liver (ARP31855)

Aviva Systems Biology is the original manufacturer of this GATA2 antibody.

Click here to view the GATA2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GATA2 antibody (ARP31855)

IHC Information:

Rabbit Anti-GATA2 Antibody
Catalog Number: ARP31855
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: GATA2 antibody - N-terminal region (ARP31855_T100) in mouse liver and N2a cell lysate using Western Blot

Product Page for GATA2 antibody - N-terminal region (ARP31855_T100)

Researcher: A Kalyani and Vinayak Gupta IIT Madras
Application: Western Blotting
Species+tissue/cell type: Lane 1: 30ug mouse liver lysate
Lane 2: 30ug mouse N2a cell lysate
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:2500

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals? Its useful in showing the expression levels of the target gene in our experimental plan
How would you rate this antibody on a scale from 1-5 (5=best) nad why? 4
Would you use this antibody in future experiment? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes
How did you store the antibody after re-suspension? In aliquots in minus twenty freezer
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Mouse liver tissue and mouse neuriblastoma cell lysate, ~30-40 ug protein
How many different experimental trials were conducted using the antibody sample? Two
How was this sample prepared? Cell lysate or tissue homogenate was prepared in  RIPA buffer with PMSF and PIC
Primary antibody dilution and incubation time: 1:500 , overnight
Secondary antibody used and dilution and incubation time: 1:5000, 1 hour
What controls were used in your experiment (positive/negative)? No
Please include your detailed WB Procedure/Protocol here: Protein from N2a cells were extracted by lysing them in appropriate amount of RIPA buffer ( with Protease inhibitor cocktail and PMSF) . Protein from mouse kidney and liver tissue were extracted by homogenizing in appropriate amount of RIPA buffer. ~30-60 µg of protein were loaded in each well transferred to a PVDF membrane, blocked for 1 hour, incubated with primary antibody dilution of 1:500 in 5%Milk  for overnight followed by washing and incubation with secondary antibody 1: 2500 in 5% milk.
 
X
Ask a Question