website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

GATA2 antibody - N-terminal region (ARP31855_T100)

Description of Target:
The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Gene Symbol:
GATA2
Official Gene Full Name:
GATA binding protein 2
NCBI Gene Id:
2624
Alias Symbols:
DCML; NFE1B; MONOMAC
Sample Type Confirmation:

GATA2 is strongly supported by BioGPS gene expression data to be expressed in K562

Tissue Tool:
Find tissues and cell lines supported to express GATA2.
Protein Accession #:
NP_116027
Nucleotide Accession#:
NM_032638
Swissprot Id:
P23769
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Endothelial transcription factor GATA-2
Protein Size (# AA):
480
Molecular Weight:
50kDa
Application:
IHC, WB
Partner Proteins:
NKX2-8
Immunogen:
The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GATA2 antibody - N-terminal region (ARP31855_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GATA2 antibody
- ARP31855_T100
Peptide Sequence:
Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Blocking Peptide:
For anti-GATA2 antibody is Catalog # AAP31855 (Previous Catalog # AAPP02650)
Key Reference:
Tsuzuki, S., et al., (2004) Mol. Cell. Biol. 24 (15), 6824-6836
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GATA2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question