CARF Antibody - C-terminal region (ARP40869_T100)

Catalog No: ARP40869_T100

WB Suggested Anti-CARF Antibody Titration: 0.3125ug/ml
Positive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CARF
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CDKN2AIP (ARP40869_T100) antibody is Catalog # AAP40869 (Previous Catalog # AAPY01104)
• Sample Type Confirmation:

  CDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Hasan,M.K., (2002) J. Biol. Chem. 277 (40), 37765-37770

Target Info

• Gene Symbol: CDKN2AIP
• Gene Full Name: CDKN2A interacting protein
• Alias Symbols: CARF
• NCBI Gene Id: 55602
• Protein Name: CDKN2A-interacting protein
• Description of Target: CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.
• Uniprot ID: Q9NXV6
• Protein Accession #: NP_060102
• Nucleotide Accession #: NM_017632
• Protein Size (# AA): 580
• Molecular Weight: 64kDa
• Protein Interactions: UBC; XRN2; RPA3; RPA2; RPA1; WHSC1; VCP; Cdkn2a; MDC1; BRCA1; BARD1; GGH; EPHX1; MDM2; CUL3; SUMO2; RAD21; DHX58; Clp1;