Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP32869_P050
Price: $0.00
SKU
ARP32869_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ARID3A (ARP32869_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARID3A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARID3A (ARP32869_P050) antibody is Catalog # AAP32869 (Previous Catalog # AAPP03889)
Sample Type Confirmation

ARID3A is supported by BioGPS gene expression data to be expressed in HepG2

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceFukuyo,Y., et al., (2004) Cell Death Differ. 11 (7), 747-759
Gene SymbolARID3A
Gene Full NameAT rich interactive domain 3A (BRIGHT-like)
Alias SymbolsDRIL1, DRIL3, BRIGHT, E2FBP1
NCBI Gene Id1820
Protein NameAT-rich interactive domain-containing protein 3A
Description of TargetARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Uniprot IDQ99856
Protein Accession #NP_005215
Nucleotide Accession #NM_005224
Protein Size (# AA)593
Molecular Weight63 kDa
Protein InteractionsNOTCH2NL; TTC32; UBC; SOX2; TP53BP1; APP; UBE2E3; TP53; SP100; PML; E2F4; E2F2; RL2; ELAVL1; SUMO2; BTK; E2F1; DSP;
  1. What is the species homology for "ARID3A Antibody - middle region (ARP32869_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish".

  2. How long will it take to receive "ARID3A Antibody - middle region (ARP32869_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARID3A Antibody - middle region (ARP32869_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARID3A Antibody - middle region (ARP32869_P050)"?

    This target may also be called "DRIL1, DRIL3, BRIGHT, E2FBP1" in publications.

  5. What is the shipping cost for "ARID3A Antibody - middle region (ARP32869_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARID3A Antibody - middle region (ARP32869_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARID3A Antibody - middle region (ARP32869_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARID3A Antibody - middle region (ARP32869_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARID3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARID3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARID3A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARID3A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARID3A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARID3A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARID3A Antibody - middle region (ARP32869_P050)
Your Rating
We found other products you might like!