- Description of Target:
- RBAK encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif. This gene encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif.
- Gene Symbol:
- RBAK
- Official Gene Full Name:
- RB-associated KRAB zinc finger
- Alias Symbols:
- ZNF769
- Tissue Tool:
- Find tissues and cell lines supported to express RBAK.

- Protein Accession# :
- NP_066986
- Nucleotide Accession#:
- NM_021163
- Swissprot Id:
- Q9NYW8
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 714
- Molecular Weight:
- 83kDa
- Application:
- WB
- Partner Proteins:
- AR, RB1
- Immunogen:
- The immunogen for anti-RBAK antibody: synthetic peptide directed towards the N terminal of human RBAK
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- RBAK antibody - N-terminal region (ARP32971_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 92%; Rat: 92%; Guinea pig: 84%; Horse: 84%; Mouse: 84%; Pig: 84%; Dog: 76%
- Datasheets / Downloads:
- Printable datasheet for
anti-RBAK antibody
- ARP32971_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: VMLENYSHLVSVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVD
- Blocking Peptide:
- For anti-RBAK antibody is Catalog # AAP32971 (Previous Catalog # AAPP03995)
- Key Reference:
- Jeske,Y.W., (2008) Clin. Exp. Pharmacol. Physiol. 35 (4), 380-385
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-RBAK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: RBAK antibody tested with Human Placenta Tissue (ARP32971_P050)
Aviva Systems Biology is the original manufacturer of this RBAK antibody (ARP32971_P050)
Click here to view the RBAK antibody Western Blot Protocol
Product Datasheet Link: RBAK antibody (ARP32971_P050)
WB Suggested Anti-RBAK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Placenta
Western Blot image: 
Description of Target: RBAK encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif. This gene encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s RBAK antibody (ARP32971_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


