POU6F2 antibody - N-terminal region (ARP31534_P050)

Catalog#: ARP31534_P050

• Size: 50ug

Human Heart lysate

• Description of Target: POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways.POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 AC011292.3 84260-84319 61-553 U91935.1 102-594 554-927 AC005483.1 150160-150533 c 928-1068 AC005483.1 83435-83575 c 1069-1275 AC005483.1 56892-57098 c 1276-1613 U91935.1 1320-1657 1614-2223 AC005483.1 25384-25993 c
• Gene Symbol: POU6F2
• Official Gene Full Name: POU class 6 homeobox 2
• Alias Symbols: RPF-1; WT5; WTSL
• Protein Accession#: NP_009183
• Nucleotide Accession#: NM_007252
• Swissprot Id: P78424
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 691
• Molecular Weight: 73kDa
• Application: WB
• Immunogen: The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPV
• Blocking Peptide: For anti-POU6F2 antibody is Catalog # AAP31534 (Previous Catalog # AAPP02296)
• Key Reference: Perotti,D., (2004) Hum. Mutat. 24 (5), 400-407
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-POU6F2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: POU6F2 antibody tested with Human Fetal Heart Tissue (ARP31534_P050)

Aviva Systems Biology is the original manufacturer of this POU6F2 antibody (ARP31534_P050)

Click here to view the POU6F2 antibody Western Blot Protocol

Product Datasheet Link: POU6F2 antibody (ARP31534_P050)

WB Suggested Anti-POU6F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways.POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 AC011292.3 84260-84319 61-553 U91935.1 102-594 554-927 AC005483.1 150160-150533 c 928-1068 AC005483.1 83435-83575 c 1069-1275 AC005483.1 56892-57098 c 1276-1613 U91935.1 1320-1657 1614-2223 AC005483.1 25384-25993 c

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s POU6F2 antibody (ARP31534_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com