MTF1 antibody - C-terminal region (ARP32027_T100)

Catalog#: ARP32027_T100

• Size: 100ug

Human HepG2

• Description of Target: The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.
• Gene Symbol: MTF1
• Official Gene Full Name: Metal-regulatory transcription factor 1
• Alias Symbols: ZRF; MTF-1
• Protein Accession#: NP_005946
• Nucleotide Accession#: NM_005955
• Swissprot Id: Q14872
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 753
• Molecular Weight: 81kDa
• Application: WB
• Partner Proteins: CREBBP, NCL, NCL
• Immunogen: The immunogen for anti-MTF1 antibody: synthetic peptide directed towards the C terminal of human MTF1
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
• Blocking Peptide: For anti-MTF1 antibody is Catalog # AAP32027 (Previous Catalog # AAPP02929)
• Key Reference: Chen,X., et al., (2004) J. Biol. Chem. 279 (6), 4515-4522
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-MTF1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: MTF1 antibody tested with Human Hepg2 Cells (ARP32027_T100)

Aviva Systems Biology is the original manufacturer of this MTF1 antibody (ARP32027_T100)

Click here to view the MTF1 antibody Western Blot Protocol

Product Datasheet Link: MTF1 antibody (ARP32027_T100)

WB Suggested Anti-MTF1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2

Western Blot image:


Description of Target: The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MTF1 antibody (ARP32027_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com