- Description of Target:
- In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
- Gene Symbol:
- HOXA7
- Official Gene Full Name:
- Homeobox A7
- Alias Symbols:
- ANTP; HOX1; HOX1A; HOX1.1
- Tissue Tool:
- Find tissues and cell lines supported to express HOXA7.
- Protein Accession# :
- NP_008827
- Nucleotide Accession#:
- NM_006896
- Swissprot Id:
- P31268
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 230
- Molecular Weight:
- 25kDa
- Application:
- WB
- Partner Proteins:
- BTG1, BTG2, CREBBP, EP300, KRTAP4-12, MDFI, RBPMS, SAT1, BTG1, BTG2, KRTAP4-12, MDFI, RBPMS, SAT1
- Immunogen:
- The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- HOXA7 antibody - N-terminal region (ARP32637_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-HOXA7 antibody
- ARP32637_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
- Blocking Peptide:
- For anti-HOXA7 antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
- Key Reference:
- Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-HOXA7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: HOXA7 antibody tested with Human Jurkat Cells (ARP32637_P050)
Aviva Systems Biology is the original manufacturer of this HOXA7 antibody (ARP32637_P050)
Click here to view the HOXA7 antibody Western Blot Protocol
Product Datasheet Link: HOXA7 antibody (ARP32637_P050)
WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat
Western Blot image: 
Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s HOXA7 antibody (ARP32637_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
