ARID3A antibody - middle region (ARP32869_P050)

Catalog#: ARP32869_P050

• Size: 50ug

Human HepG2

• Description of Target: ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
• Gene Symbol: ARID3A
• Official Gene Full Name: AT rich interactive domain 3A (BRIGHT-like)
• Alias Symbols: DRIL1; DRIL3; BRIGHT; E2FBP1
• Protein Accession#: NP_005215
• Nucleotide Accession#: NM_005224
• Swissprot Id: Q99856
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 593
• Molecular Weight: 63kDa
• Application: WB
• Immunogen: The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the middle region of human ARID3A
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
• Blocking Peptide: For anti-ARID3A antibody is Catalog # AAP32869 (Previous Catalog # AAPP03889)
• Key Reference: Fukuyo,Y., et al., (2004) Cell Death Differ. 11 (7), 747-759
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-ARID3A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ARID3A antibody tested with Human Hepg2 Cells (ARP32869_P050)

Aviva Systems Biology is the original manufacturer of this ARID3A antibody (ARP32869_P050)

Click here to view the ARID3A antibody Western Blot Protocol

Product Datasheet Link: ARID3A antibody (ARP32869_P050)

WB Suggested Anti-ARID3A Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ARID3A antibody (ARP32869_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com