- Description of Target:
- Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
- Gene Symbol:
- Ywhag
- Official Gene Full Name:
- Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
- Alias Symbols:
- 14-3-3gamma; D7Bwg1348e
- Tissue Tool:
- Find tissues and cell lines supported to express Ywhag.
- Protein Accession# :
- NP_061359
- Nucleotide Accession#:
- NM_018871
- Swissprot Id:
- P61982
- Host:
- Rabbit
- Protein Size (# AA):
- 247
- Molecular Weight:
- 28kDa
- Application:
- WB
- Partner Proteins:
- Lmna,SNCA
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Ywhag antibody - N-terminal region (ARP30643_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Ywhag antibody
- ARP30643_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
- Blocking Peptide:
- For anti-Ywhag antibody is Catalog # AAP30643
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Ywhag antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
