WNT9B Antibody - middle region (ARP41242_P050)

Catalog No: ARP41242_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-WNT9B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT9B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WNT9B (ARP41242_P050) antibody is Catalog # AAP41242 (Previous Catalog # AAPS01409)
• Reference: Chiquet,B.T., (er) Hum. Mol. Genet. (2008) In press

Target Info

• Gene Symbol: WNT9B
• Gene Full Name: Wingless-type MMTV integration site family, member 9B
• Alias Symbols: WNT15, WNT14B
• NCBI Gene Id: 7484
• Protein Name: Protein Wnt-9b
• Description of Target: WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a signaling molecule which affects the development of discrete regions of tissues. WNT9B is likely to signal over only few cell diameters.The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region.
• Uniprot ID: O14905
• Protein Accession #: NP_003387
• Nucleotide Accession #: NM_003396
• Protein Size (# AA): 357
• Molecular Weight: 37kDa
• Protein Interactions: MGMT;