website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

WDR4 antibody - C-terminal region (ARP41321_T100)

Description of Target:
WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
WDR4
Official Gene Full Name:
WD repeat domain 4
NCBI Gene Id:
10785
Alias Symbols:
TRM82
Tissue Tool:
Find tissues and cell lines supported to express WDR4.
Protein Accession #:
NP_387510
Nucleotide Accession#:
NM_033661
Swissprot Id:
P57081
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Protein Size (# AA):
412
Molecular Weight:
45kDa
Application:
IHC, WB
Subunit:
WDR4
Immunogen:
The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
WDR4 antibody - C-terminal region (ARP41321_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 93%; Bovine: 93%; Pig: 90%; Mouse: 87%; Rabbit: 83%; Rat: 75%; Yeast: 75%
Species Reactivity:
Human, Bovine, Horse, Pig, Mouse, Rabbit, Rat, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-WDR4 antibody
- ARP41321_T100
Peptide Sequence:
Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
Blocking Peptide:
For anti-WDR4 antibody is Catalog # AAP41321 (Previous Catalog # AAPP22676)
Key Reference:
Michaud,J., (2000) Genomics 68 (1), 71-79
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-WDR4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question