website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


WDR4 antibody - C-terminal region (ARP41321_T100)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    WD repeat domain 4
    Protein Name:
    tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Description of Target:
    WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
    Protein Size (# AA):
    Molecular Weight:
    Protein A purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express WDR4.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express WDR4.
    The immunogen is a synthetic peptide directed towards the C terminal region of human WDR4
    Species Reactivity:
    Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
    Predicted Homology Based on Immunogen Sequence:
    Cow: 93%; Horse: 93%; Human: 100%; Mouse: 87%; Pig: 90%; Rabbit: 83%; Rat: 75%; Yeast: 75%
    Complete computational species homology data:
    Anti-WDR4 (ARP41321_T100)
    Peptide Sequence:
    Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-WDR4 (ARP41321_T100) antibody is Catalog # AAP41321 (Previous Catalog # AAPP22676)
    Datasheets / Downloads:
    Printable datasheet for anti-WDR4 (ARP41321_T100) antibody
    Target Reference:
    Michaud,J., (2000) Genomics 68 (1), 71-79

    Product Protocols: WDR4 antibody tested with Human Hepg2 Cells (ARP41321_T100)

    Aviva Systems Biology is the original manufacturer of this WDR4 antibody (ARP41321_T100)

    Click here to view the WDR4 antibody Western Blot Protocol

    Product Datasheet Link: WDR4 antibody (ARP41321_T100)

    WB Suggested Anti-WDR4 Antibody Titration: 1.25ug/ml
    Positive Control: HepG2

    Western Blot image:

    Description of Target: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s WDR4 antibody (ARP41321_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Protocols: WDR4 antibody tested by IHC with human kidney (ARP41321)

    Aviva Systems Biology is the original manufacturer of this WDR4 antibody.

    Click here to view the WDR4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: WDR4 antibody (ARP41321)

    IHC Information:

    Rabbit Anti-WDR4 Antibody
    Catalog Number: ARP41321
    Paraffin Embedded Tissue: Human Kidney
    Cellular Data: Epithelial cells of renal tubule
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Ask a Question