website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

WDR4 antibody - C-terminal region (ARP41321_T100)

Description of Target:
WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
Official Gene Full Name:
WD repeat domain 4
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express WDR4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
WDR4 antibody - C-terminal region (ARP41321_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 93%; Bovine: 93%; Pig: 90%; Mouse: 87%; Rabbit: 83%; Rat: 75%; Yeast: 75%
Species Reactivity:
Human, Bovine, Horse, Pig, Mouse, Rabbit, Rat, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-WDR4 antibody
- ARP41321_T100
Peptide Sequence:
Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
Blocking Peptide:
For anti-WDR4 antibody is Catalog # AAP41321 (Previous Catalog # AAPP22676)
Target Reference:
Michaud,J., (2000) Genomics 68 (1), 71-79
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-WDR4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for WDR4 antibody (ARP41321)

Product page for WDR4 antibody (ARP41321)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant WDR4 antibody; Loxodonta africana WDR4 antibody G5E772 92%
Bovine WDR4 antibody; Bos taurus WDR4 antibody A7E3S5 92%
Duckbill platypus WDR4 antibody; Ornithorhynchus anatinus WDR4 antibody F6R4G0 91%
Gray short-tailed opossum WDR4 antibody; Monodelphis domestica WDR4 antibody F6QYZ8 85%
Horse WDR4 antibody; Equus caballus WDR4 antibody F7A7H0 92%
Human WDR4 antibody; Homo sapiens WDR4 antibody P57081 100%
Human WDR4 antibody; Homo sapiens WDR4 antibody P57081-3 100%
Human WDR4 antibody; Homo sapiens WDR4 antibody P57081-2 100%
Little brown bat WDR4 antibody; Myotis lucifugus WDR4 antibody G1P3G7 91%
Lowland gorilla WDR4 antibody; Gorilla gorilla gorilla WDR4 antibody G3RKI4 100%
Mouse WDR4 antibody; Mus musculus WDR4 antibody Q9EP82 86%
Mouse Wdr4 antibody; Mus musculus Wdr4 antibody E9Q156 86%
Northern white-cheeked gibbon WDR4 antibody; Nomascus leucogenys WDR4 antibody G1RX56 100%
Rabbit UACA antibody; Oryctolagus cuniculus UACA antibody G1TUF7 83%
Rabbit UACA antibody; Oryctolagus cuniculus UACA antibody G1T658 83%
Rat Wdr4 antibody; Rattus norvegicus Wdr4 antibody D3ZY48 80%
Rhesus macaque WDR4 antibody; Macaca mulatta WDR4 antibody F7G5I5 100%
Rhesus macaque WDR4 antibody; Macaca mulatta WDR4 antibody F7FIV9 100%
Small-eared galago WDR4 antibody; Otolemur garnettii WDR4 antibody H0WN75 84%
Tasmanian devil WDR4 antibody; Sarcophilus harrisii WDR4 antibody G3WVB1 85%
White-tufted-ear marmoset WDR4 antibody; Callithrix jacchus WDR4 antibody F7IRV7 92%
White-tufted-ear marmoset WDR4 antibody; Callithrix jacchus WDR4 antibody F7HM02 92%
Zebra finch WDR4 antibody; Taeniopygia guttata WDR4 antibody H0Z5Q1 84%

Product Protocols: WDR4 antibody tested with Human Hepg2 Cells (ARP41321_T100)

Aviva Systems Biology is the original manufacturer of this WDR4 antibody (ARP41321_T100)

Click here to view the WDR4 antibody Western Blot Protocol

Product Datasheet Link: WDR4 antibody (ARP41321_T100)

WB Suggested Anti-WDR4 Antibody Titration: 1.25ug/ml
Positive Control: HepG2

Western Blot image:

Description of Target: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s WDR4 antibody (ARP41321_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: WDR4 antibody tested by IHC with human kidney (ARP41321)

Aviva Systems Biology is the original manufacturer of this WDR4 antibody.

Click here to view the WDR4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: WDR4 antibody (ARP41321)

IHC Information:

Rabbit Anti-WDR4 Antibody
Catalog Number: ARP41321
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question