website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

WDR4 antibody - C-terminal region (ARP41321_T100)

Description of Target:
WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
WDR4
Official Gene Full Name:
WD repeat domain 4
NCBI Gene Id:
10785
Alias Symbols:
TRM82
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WDR4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WDR4.
Swissprot Id:
P57081
Protein Accession #:
NP_387510
Nucleotide Accession #:
NM_033661
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Protein Size (# AA):
412
Molecular Weight:
45kDa
Application:
IHC, WB
Subunit:
WDR4
Protein Interactions:
FAM118A; RABGGTB; METTL1; LGR4; CUL5; PDE12; WDR92; DCTPP1; P3H1; ELAC2; XPO5; NPLOC4; UBE2R2; DPP8; PPME1; ERO1L; UBQLN2; DBNL; KIAA1279; ARIH1; HSPBP1; PLIN3; ACTR2; SAE1; ASMTL; OGT; SURF2; SRP14; DNAJB1; DDX5; ALAD; ADSL; ERC1; UBP1; UBE2D1; TERF2; TE
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human WDR4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
Anti-WDR4 (ARP41321_T100)
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Horse: 93%; Human: 100%; Mouse: 87%; Pig: 90%; Rabbit: 83%; Rat: 75%; Yeast: 75%
Species Reactivity:
Cow; Horse; Human; Mouse; Pig; Rabbit; Rat; Yeast
Datasheets / Downloads:
Printable datasheet for anti-WDR4 (ARP41321_T100) antibody
Peptide Sequence:
Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
Blocking Peptide:
For anti-WDR4 (ARP41321_T100) antibody is Catalog # AAP41321 (Previous Catalog # AAPP22676)
Target Reference:
Michaud,J., (2000) Genomics 68 (1), 71-79
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: WDR4 antibody tested with Human Hepg2 Cells (ARP41321_T100)

Aviva Systems Biology is the original manufacturer of this WDR4 antibody (ARP41321_T100)

Click here to view the WDR4 antibody Western Blot Protocol

Product Datasheet Link: WDR4 antibody (ARP41321_T100)

WB Suggested Anti-WDR4 Antibody Titration: 1.25ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s WDR4 antibody (ARP41321_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: WDR4 antibody tested by IHC with human kidney (ARP41321)

Aviva Systems Biology is the original manufacturer of this WDR4 antibody.

Click here to view the WDR4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: WDR4 antibody (ARP41321)

IHC Information:

Rabbit Anti-WDR4 Antibody
Catalog Number: ARP41321
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question