website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

RAD17 antibody - C-terminal region (ARP30206_T100)

Description of Target:
RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.
Gene Symbol:
Official Gene Full Name:
RAD17 homolog (S. pombe)
NCBI Gene Id:
Alias Symbols:
CCYC; HRAD17; R24L; RAD17Sp; Rad24; RAD24; RAD17SP
Sample Type Confirmation:

RAD17 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express RAD17.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Cell cycle checkpoint protein RAD17
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
RAD17 antibody - C-terminal region (ARP30206_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 83%; Bovine: 83%; Dog: 75%; Rat: 75%; Mouse: 75%
Species Reactivity:
Human, Bovine, Pig, Dog, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RAD17 antibody
- ARP30206_T100
Peptide Sequence:
Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Blocking Peptide:
For anti-RAD17 antibody is Catalog # AAP30206 (Previous Catalog # AAPS09009)
Target Reference:
Tsao,C.C., (2004) EMBO J. 23 (23), 4660-4669
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for RAD17 antibody (ARP30206)

Product page for RAD17 antibody (ARP30206)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100661705 antibody; Loxodonta africana LOC100661705 antibody G3T8R9 75%
Bovine RAD17 antibody; Bos taurus RAD17 antibody E1BPL7 83%
Bovine RAD17 antibody; Bos taurus RAD17 antibody A6QNK6 83%
Chinese hamster Rad17 antibody; Cricetulus griseus Rad17 antibody G3HRV9 75%
Dog RAD17 antibody; Canis familiaris RAD17 antibody E2R410 75%
Duckbill platypus RAD17 antibody; Ornithorhynchus anatinus RAD17 antibody F7ESS6 75%
Green monkey RAD17 antibody; Chlorocebus aethiops RAD17 antibody Q9XT62 100%
Human RAD17 antibody; Homo sapiens RAD17 antibody O75943 100%
Human RAD17 antibody; Homo sapiens RAD17 antibody O75943-4 100%
Human RAD17 antibody; Homo sapiens RAD17 antibody O75943-3 100%
Human RAD17 antibody; Homo sapiens RAD17 antibody O75943-2 100%
Little brown bat RAD17 antibody; Myotis lucifugus RAD17 antibody G1NWK0 83%
Lowland gorilla RAD17 antibody; Gorilla gorilla gorilla RAD17 antibody G3RR37 100%
Lowland gorilla RAD17 antibody; Gorilla gorilla gorilla RAD17 antibody G3RHP7 100%
Mouse RAD17 antibody; Mus musculus RAD17 antibody Q6NXW6 75%
Mouse Rad17 antibody; Mus musculus Rad17 antibody Q3UYY2 75%
Northern white-cheeked gibbon RAD17 antibody; Nomascus leucogenys RAD17 antibody G1QW14 91%
Northern white-cheeked gibbon RAD17 antibody; Nomascus leucogenys RAD17 antibody G1QW11 91%
Pig RAD17 antibody; Sus scrofa RAD17 antibody F1SKR7 83%
Rat Rad17 antibody; Rattus norvegicus Rad17 antibody Q4V7A2 75%
Rat Rad17 antibody; Rattus norvegicus Rad17 antibody E9PTL1 75%
Rhesus macaque RAD17 antibody; Macaca mulatta RAD17 antibody F7GYW7 100%
Rhesus macaque RAD17 antibody; Macaca mulatta RAD17 antibody F6TWN8 100%
Rhesus macaque RAD17 antibody; Macaca mulatta RAD17 antibody F6TWL5 100%
Rhesus macaque RAD17 antibody; Macaca mulatta RAD17 antibody F6TWK4 100%
Small-eared galago RAD17 antibody; Otolemur garnettii RAD17 antibody H0XMH3 91%
strain SH3 pldA antibody; Dictyostelium fasciculatum pldA antibody F4Q5P8 81%
Sumatran orangutan RAD17 antibody; Pongo abelii RAD17 antibody Q5R652 100%
White-tufted-ear marmoset RAD17 antibody; Callithrix jacchus RAD17 antibody F7HKR4 91%

Product Protocols: RAD17 antibody tested with Human Jurkat Cells (ARP30206_T100)

Aviva Systems Biology is the original manufacturer of this RAD17 antibody (ARP30206_T100)

Click here to view the RAD17 antibody Western Blot Protocol

Product Datasheet Link: RAD17 antibody (ARP30206_T100)

WB Suggested Anti-RAD17 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RAD17 antibody (ARP30206_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: RAD17 antibody -C-terminal region (ARP30206_T100) in Hela lysate, HEK293T lysate, Xenopus laevis egg extract and mouse embryonic stem cells using Western Blot

Product Page for RAD17 antibody-C-terminal region (ARP30206_T100)

Application:Western blotting
Researcher:Domenico Maiorano, Institute of Human Genetics, CNRS
Species+tissue/cell type:
Lane1: 25ug Hela lysate
Lane2: 25ug HEK293T lysate
Lane3: 25ug Xenopus laevis egg extract
Lane4: 25ug mouse embryonic stem cells lysate
Primary antibody dilution:1:500
Secondary antibody:Anti-rabbit-HRP
Secondary antibody dilution:1:3000

Have you used another antibody which has worked in your application? YES
How did you store the antibody after re-suspension? 4°C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 1) H. sapiens, M. musculus, X. laevis; 2) Hela cell lysate, mouse embryonic stem cells lysate, Xenopus egg extracts; 3) 25 ug protein per lane.
How many different experimental trials were conducted using the antibody sample? 5
How was this sample prepared? Hela cell and mouse embryonic stem cells lysates were prpared by lysing  cells direct in into Laemmli buffer followed by boiling. Xenopus egg extracts were prepared by low speed (10 000 g) centrifugation of activated layed eggs, followed by inactivation in Laemmli buffer and boiling.
Primary antibody dilution and incubation time: 1:500 in TBS/0.1% Twenn-20, incubated over night at 4°C
Secondary antibody used and dilution and incubation time: 1:3000 in 5% non-fat milk in TBS/0.1% Tween -20
What controls were used in your experiment (positive/negative)? B-actin: positive control.
Please include your detailed WB Procedure/Protocol here: Proteins fractionated on 10% SDS-PAGE were transferred to nitrocellulose membrane (Protran, Whatmann) for 1 hour at 4°C in Tris-glycine buffer supplemented with 20% Ethanol. Membranes were blocked for 1 hour at room temperature with  5% non-fat milk in TBS/0.1% Tween -20. Membranes were incubated over night with primary antibody at 4°C on a shaker. The day after membranes were washed three time for 10 minutes each in TBS/0.1% Tween -20 at room temperature. Membranes were incubated with secondary antibodies in 5% non-fat milk in TBS/0.1% Tween -20 for 4 hours at room temperature on a shaker, then membranes were washed as above and revealed  by ECL (illuminata, crescendo, Millipore).
Ask a Question