website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

RAD17 antibody - C-terminal region (ARP30206_T100)

Description of Target:
RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.
Gene Symbol:
RAD17
Official Gene Full Name:
RAD17 homolog (S. pombe)
NCBI Gene Id:
5884
Alias Symbols:
CCYC; HRAD17; R24L; RAD17Sp; Rad24; RAD24; RAD17SP
Sample Type Confirmation:

RAD17 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express RAD17.
Protein Accession #:
NP_579919
Nucleotide Accession#:
NM_133341
Swissprot Id:
O75943-4
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Cell cycle checkpoint protein RAD17
Protein Size (# AA):
584
Molecular Weight:
66kDa
Application:
WB
Partner Proteins:
CALM1, COPB1, COPB2, ERBB3, GNAI1, GNAI2, GNAO1, GNAQ, PLCB1, PTAFR, COPB2, ERBB3, GNAI1, GNAI1, GNAI2, GNAI2, GNAI3, GNAO1, GNAQ, GNAQ, GNAT1
Immunogen:
The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
RAD17 antibody - C-terminal region (ARP30206_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 83%; Bovine: 83%; Dog: 75%; Rat: 75%; Mouse: 75%
Species Reactivity:
Human, Bovine, Pig, Dog, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RAD17 antibody
- ARP30206_T100
Peptide Sequence:
Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Blocking Peptide:
For anti-RAD17 antibody is Catalog # AAP30206 (Previous Catalog # AAPS09009)
Key Reference:
Tsao,C.C., (2004) EMBO J. 23 (23), 4660-4669
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-RAD17 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question