IL3RA Antibody - C-terminal region (ARP74006_P050)

Catalog No: ARP74006_P050

Host: Rabbit
Target Name: IL3RA
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL3RA
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: CRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL3RA (ARP74006_P050) antibody is Catalog # AAP74006

Target Info

• Gene Symbol: IL3RA
• Alias Symbols: IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra
• NCBI Gene Id: 3563
• Description of Target: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found.
• Uniprot ID: P26951
• Protein Accession #: XP_005274837
• Protein Size (# AA): 378
• Molecular Weight: 41kDa
• Protein Interactions: LNX1; FOXP1; SGK2; SAE1; NR0B2; GNA12; CDC25A; CDK1; PPP1CC; JAK1; IL3; CSF2RB; CSF2; CISH; JAK2;