- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-HCLS1 (ARP32615_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-HCLS1 (ARP32615_T100) antibody is Catalog # AAP32615 (Previous Catalog # AAPP03624) |
Sample Type Confirmation | HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat |
Reference | Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47 |
Gene Symbol | HCLS1 |
---|---|
Gene Full Name | Hematopoietic cell-specific Lyn substrate 1 |
Alias Symbols | HS1, p75, CTTNL, lckBP1 |
NCBI Gene Id | 3059 |
Protein Name | Hematopoietic lineage cell-specific protein |
Description of Target | HS1 which is hematopoietic lineage cell-specific protein 1, is a substrate of protein tyrosine kinases in lymphocytes, it binds to F-actin, and promotes Arp2/3 complex-mediated actin polymerization. However, the mechanism for the interaction between HS1 and F-actin has not yet been fully characterized. HS1 contains 3.5 tandem repeats, a coiled-coil region, and an SH3 domain at the C terminus. Unlike cortactin, which is closely related to HS1 and requires absolutely the repeat domain for F-actin binding, an HS1 mutant with deletion of the repeat domain maintains a significant F-actin binding activity. Deletion of the coiled-coil region abolished the ability of HS1 to bind to actin filaments and to activate the Arp2/3 complex for actin nucleation and actin branching. |
Uniprot ID | P14317 |
Protein Accession # | NP_005326 |
Nucleotide Accession # | NM_005335 |
Protein Size (# AA) | 486 |
Molecular Weight | 54kDa |
Protein Interactions | SH2D4A; UBC; Mbp; Dlg4; NOTCH1; QKI; TERF1; TRIM29; SSBP3; BLZF1; IKBKG; LZTR1; ZBTB25; HS1BP3; HAX1; ACTR2; MAP4K1; CASP3; SYK; WAS; LYN; FGR; CSNK2A1; CD79A; ACTA1; GRB2; ACTR3; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".
-
How long will it take to receive "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "HCLS1 Antibody - N-terminal region (ARP32615_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
This target may also be called "HS1, p75, CTTNL, lckBP1" in publications.
-
What is the shipping cost for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "54kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HCLS1 Antibody - N-terminal region (ARP32615_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HCLS1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HCLS1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HCLS1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HCLS1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HCLS1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HCLS1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.