website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GNB2L1 antibody - N-terminal region (ARP40624_P050)

Description of Target:
GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.
Gene Symbol:
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
NCBI Gene Id:
Alias Symbols:
Gnb2-rs1; H12.3; HLC-7; PIG21; RACK1
Tissue Tool:
Find tissues and cell lines supported to express GNB2L1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Guanine nucleotide-binding protein subunit beta-2-like 1
Protein Size (# AA):
Molecular Weight:
beta-2-like 1
Protein Interactions:
The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the N terminal of human GNB2L1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
GNB2L1 antibody - N-terminal region (ARP40624_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Sheep, Human, Dog, Rabbit, Rat, Guinea pig, Yeast, Bovine, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GNB2L1 antibody
- ARP40624_P050
Peptide Sequence:
Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
Blocking Peptide:
For anti-GNB2L1 antibody is Catalog # AAP40624 (Previous Catalog # AAPP22384)
Target Reference:
Parent,A., (2008) Traffic 9 (3), 394-407
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GNB2L1 antibody (ARP40624)

Product page for GNB2L1 antibody (ARP40624)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog gnb2l1 antibody; Xenopus laevis gnb2l1 antibody Q8AVP6 100%
African clawed frog gnb2l1 antibody; Xenopus laevis gnb2l1 antibody Q5U275 100%
African clawed frog RACK1 antibody; Xenopus laevis RACK1 antibody Q9W7I1 100%
African elephant GNB2L1 antibody; Loxodonta africana GNB2L1 antibody G3T837 100%
Albugo laibachii Nc14 AlNc14C373G11128 antibody F0WY68 92%
Alfalfa GBLP antibody; Medicago sativa GBLP antibody O24076 83%
Atlantic salmon GBLP antibody; Salmo salar GBLP antibody C0H7X9 100%
Atlantic salmon gnb2l1 antibody; Salmo salar gnb2l1 antibody B5DFX3 100%
Bloodfluke planorb GBLP antibody; Biomphalaria glabrata GBLP antibody Q93134 92%
blue catfish GBLP antibody; Ictalurus furcatus GBLP antibody E3TCG2 100%
Bovine GBLP antibody; Bos taurus GBLP antibody P63243 100%
Bovine GNB2L1 antibody; Bos taurus GNB2L1 antibody Q862T3 100%
Channel catfish gblp antibody; Ictalurus punctatus gblp antibody E3TEA2 100%
Chicken GBLP antibody; Gallus gallus GBLP antibody P63247 100%
Chicken GNB2L1 antibody; Gallus gallus GNB2L1 antibody G8JL27 100%
Chlamydomonas incerta cblP antibody Q1WLW3 100%
Chlamydomonas incerta cblP antibody Q1WLT6 100%
Chlamydomonas smithii Cblp antibody; Chlamydomonas reinhardtii Cblp antibody B2XYE5 100%
Chlamydomonas smithii GBLP antibody; Chlamydomonas reinhardtii GBLP antibody P25387 100%
Chlamydomonas smithii RACK1 antibody; Chlamydomonas reinhardtii RACK1 antibody A8J8Y1 100%
Common tobacco arcA 3 antibody; Nicotiana tabacum arcA 3 antibody O65851 91%
Common tobacco GBLP antibody; Nicotiana tabacum GBLP antibody P49026 91%
Common turkey GNB2L1 antibody; Meleagris gallopavo GNB2L1 antibody B1N1C2 100%
Crab-eating macaque GBLP antibody; Macaca fascicularis GBLP antibody Q4R7Y4 100%
Dog GNB2L1 antibody; Canis familiaris GNB2L1 antibody F1PLR0 100%
Duckbill platypus GNB2L1 antibody; Ornithorhynchus anatinus GNB2L1 antibody F7E8M7 100%
Dumeril clam worm RACK1 antibody; Platynereis dumerilii RACK1 antibody D2D3S7 91%
Gliocladium virens cpc2 antibody; Hypocrea virens cpc2 antibody G9MVI8 100%
Grape LOC100249027 antibody; Vitis vinifera LOC100249027 antibody A5BV59 83%
Gray short-tailed opossum GNB2L1 antibody; Monodelphis domestica GNB2L1 antibody F6VVG7 100%
Green alga RACK1 antibody; Chlorella variabilis RACK1 antibody E1ZDM9 84%
Green alga RACK1 antibody; Dunaliella salina RACK1 antibody G3LTV5 92%
Green anole GNB2L1 antibody; Anolis carolinensis GNB2L1 antibody G1KLU0 100%
Guinea pig GNB2L1 antibody; Cavia porcellus GNB2L1 antibody H0VCZ6 100%
Human GBLP antibody; Homo sapiens GBLP antibody P63244 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody H0YAF8 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody H0Y8W2 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody E9PD14 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody E9KL35 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6RHH4 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6RFZ9 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6RFX4 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6RDF4 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6RAU2 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6R9Z1 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody D6R9L0 100%
Human GNB2L1 antibody; Homo sapiens GNB2L1 antibody H0YAM7 100%
Japanese lamprey GNB2L1 antibody; Lampetra japonica GNB2L1 antibody Q1XGE0 100%
Kidney bean RACK antibody; Phaseolus vulgaris RACK antibody B7T1N8 83%
Leadwort-leaved tobacco GBLP antibody; Nicotiana plumbaginifolia GBLP antibody P93340 91%
Little brown bat GNB2L1 antibody; Myotis lucifugus GNB2L1 antibody G1PSI0 100%
Lowland gorilla GNB2L1 antibody; Gorilla gorilla gorilla GNB2L1 antibody G3S3M6 100%
Mouse GBLP antibody; Mus musculus GBLP antibody P68040 100%
Mouse-ear cress GBLPA antibody; Arabidopsis thaliana GBLPA antibody O24456 83%
Mouse-ear cress GBLPA antibody; Arabidopsis thaliana GBLPA antibody O24456-2 83%
Mouse-ear cress GPLPB antibody; Arabidopsis thaliana GPLPB antibody Q9C4Z6 84%
Mouse-ear cress GPLPC antibody; Arabidopsis thaliana GPLPC antibody Q9LV28 92%
Nile tilapia GBLP antibody; Oreochromis niloticus GBLP antibody O42249 92%
Noble rot fungus BofuT4_P057460.1 antibody; Botryotinia fuckeliana BofuT4_P057460.1 antibody G2XUJ6 100%
Northern pike GBLP antibody; Esox lucius GBLP antibody C1BZP4 100%
Northern white-cheeked gibbon GNB2L1 antibody; Nomascus leucogenys GNB2L1 antibody G1QR41 100%
Panama disease fungus fgb2 antibody; Fusarium oxysporum fgb2 antibody Q65YU3 100%
Paramisgurnus dabryanus GNB2L1 antibody C9E2R1 100%
Pig GBLP antibody; Sus scrofa GBLP antibody P63246 100%
Rabbit NYDAS1 antibody; Oryctolagus cuniculus NYDAS1 antibody Q864T1 100%
Rainbow smelt GBLP antibody; Osmerus mordax GBLP antibody C1BLK6 100%
Rainbow trout LOC100136700 antibody; Oncorhynchus mykiss LOC100136700 antibody A9XEM9 100%
Rape GBLP antibody; Brassica napus GBLP antibody Q39336 83%
Rat GBLP antibody; Rattus norvegicus GBLP antibody P63245 100%
Rhesus macaque LOC708526 antibody; Macaca mulatta LOC708526 antibody F7DUC8 100%
Rice GBLPA antibody; Oryza sativa subsp. japonica GBLPA antibody P49027 84%
Rice GBLPB antibody; Oryza sativa subsp. japonica GBLPB antibody Q6L4F8 92%
Sablefish GBLP antibody; Anoplopoma fimbria GBLP antibody C3KHC5 76%
Shiitake mushroom Gb1 antibody; Lentinula edodes Gb1 antibody Q870G6 91%
Sorghum Sb09g027690 antibody; Sorghum bicolor Sb09g027690 antibody C5YV24 84%
Soybean GBLP antibody; Glycine max GBLP antibody Q39836 83%
Soybean LOC100778205 antibody; Glycine max LOC100778205 antibody C6TJD3 83%
Spotted green pufferfish GNB2L1 antibody; Tetraodon nigroviridis GNB2L1 antibody Q4SDS8 78%
strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987 GBLP antibody; Neurospora crassa GBLP antibody Q01369 100%
strain CCE9901 RACK1B antibody; Ostreococcus lucimarinus RACK1B antibody A4S6H8 100%
strain QM6a cpc2 antibody; Hypocrea jecorina cpc2 antibody G0RBD3 100%
Tasmanian devil GNB2L1 antibody; Sarcophilus harrisii GNB2L1 antibody G3WI55 100%
Three-spined stickleback GNB2L1 antibody; Gasterosteus aculeatus GNB2L1 antibody G3Q232 78%
Three-spined stickleback GNB2L1 antibody; Gasterosteus aculeatus GNB2L1 antibody G3Q227 78%
Tomato ArcA1 antibody; Solanum lycopersicum ArcA1 antibody Q9SXR9 91%
Tomato ArcA2 antibody; Solanum lycopersicum ArcA2 antibody Q9SXS0 91%
Trichoderma atroviride IMI 206040 cpc2 antibody G9P5L4 100%
Western clawed frog gnb2l1 antibody; Xenopus tropicalis gnb2l1 antibody Q6DIV0 100%
White-tufted-ear marmoset LOC100394803 antibody; Callithrix jacchus LOC100394803 antibody F7ICV3 100%
Zebrafish GBLP antibody; Danio rerio GBLP antibody O42248 100%
Zebrafish gnb2l1 antibody; Danio rerio gnb2l1 antibody A7E2L4 100%

Product Protocols: GNB2L1 antibody tested with Human Transfected 293T Cells (ARP40624_P050)

Aviva Systems Biology is the original manufacturer of this GNB2L1 antibody (ARP40624_P050)

Click here to view the GNB2L1 antibody Western Blot Protocol

Product Datasheet Link: GNB2L1 antibody (ARP40624_P050)

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T

Western Blot image:

Description of Target: GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GNB2L1 antibody (ARP40624_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question