website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GNB2L1 antibody - N-terminal region (ARP40624_P050)

  • Catalog#: ARP40624_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    GNB2L1
    NCBI Gene Id:
    10399
    Official Gene Full Name:
    Guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
    Protein Name:
    Guanine nucleotide-binding protein subunit beta-2-like 1
    Swissprot Id:
    P63244
    Protein Accession #:
    NP_006089
    Nucleotide Accession #:
    NM_006098
    Alias Symbols:
    Gnb2-rs1, H12.3, HLC-7, PIG21, RACK1
    Description of Target:
    GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.
    Protein Size (# AA):
    317
    Molecular Weight:
    35kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express GNB2L1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express GNB2L1.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1
    Species Reactivity:
    Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-GNB2L1 (ARP40624_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    MKRN2; LARP4B; HUWE1; UBC; SUMO2; HIF1A; STAU1; TARDBP; ADRB2; PRKCB; TRIM45; RNF2; EZH2; BMI1; SUZ12; rev; PTOV1; RPS8; RPS6; RPS5; RPS3A; RPS27L; EIF3K; SYNCRIP; DYNLL1; RPS3; RPSA; EIF3E; DYNC1LI2; RPS9; RPS27; RPS21; RPS20; RPS18; RPS16; RPS13; RPS12;
    Blocking Peptide:
    For anti-GNB2L1 (ARP40624_P050) antibody is Catalog # AAP40624 (Previous Catalog # AAPP22384)
    Datasheets / Downloads:
    Printable datasheet for anti-GNB2L1 (ARP40624_P050) antibody
    Subunit:
    beta-2-like 1
    Target Reference:
    Parent,A., (2008) Traffic 9 (3), 394-407

    Product Protocols: GNB2L1 antibody tested with Human Transfected 293T Cells (ARP40624_P050)

    Aviva Systems Biology is the original manufacturer of this GNB2L1 antibody (ARP40624_P050)

    Click here to view the GNB2L1 antibody Western Blot Protocol

    Product Datasheet Link: GNB2L1 antibody (ARP40624_P050)

    WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:12500
    Positive Control: Transfected 293T

    Western Blot image:


    Description of Target: GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s GNB2L1 antibody (ARP40624_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question