website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

GNB2L1 antibody - N-terminal region (ARP40624_P050)

Description of Target:
GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.
Gene Symbol:
GNB2L1
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
NCBI Gene Id:
10399
Alias Symbols:
Gnb2-rs1; H12.3; HLC-7; PIG21; RACK1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNB2L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNB2L1.
Swissprot Id:
P63244
Protein Accession #:
NP_006089
Nucleotide Accession #:
NM_006098
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Guanine nucleotide-binding protein subunit beta-2-like 1
Protein Size (# AA):
317
Molecular Weight:
35kDa
Application:
IHC, WB
Subunit:
beta-2-like 1
Protein Interactions:
MKRN2; LARP4B; HUWE1; UBC; SUMO2; HIF1A; STAU1; TARDBP; ADRB2; PRKCB; TRIM45; RNF2; EZH2; BMI1; SUZ12; rev; PTOV1; RPS8; RPS6; RPS5; RPS3A; RPS27L; EIF3K; SYNCRIP; DYNLL1; RPS3; RPSA; EIF3E; DYNC1LI2; RPS9; RPS27; RPS21; RPS20; RPS18; RPS16; RPS13; RPS12;
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-GNB2L1 (ARP40624_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Human; Mouse; Rabbit; Rat; Sheep; Yeast; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-GNB2L1 (ARP40624_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
Blocking Peptide:
For anti-GNB2L1 (ARP40624_P050) antibody is Catalog # AAP40624 (Previous Catalog # AAPP22384)
Target Reference:
Parent,A., (2008) Traffic 9 (3), 394-407
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GNB2L1 antibody tested with Human Transfected 293T Cells (ARP40624_P050)

Aviva Systems Biology is the original manufacturer of this GNB2L1 antibody (ARP40624_P050)

Click here to view the GNB2L1 antibody Western Blot Protocol

Product Datasheet Link: GNB2L1 antibody (ARP40624_P050)

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GNB2L1 antibody (ARP40624_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question