website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GNB2L1 antibody - N-terminal region (ARP40624_P050)

Description of Target:
GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.
Gene Symbol:
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
NCBI Gene Id:
Alias Symbols:
Gnb2-rs1; H12.3; HLC-7; PIG21; RACK1
Tissue Tool:
Find tissues and cell lines supported to express GNB2L1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Guanine nucleotide-binding protein subunit beta-2-like 1
Protein Size (# AA):
Molecular Weight:
beta-2-like 1
Partner Proteins:
The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the N terminal of human GNB2L1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
GNB2L1 antibody - N-terminal region (ARP40624_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Sheep, Human, Dog, Rabbit, Rat, Guinea pig, Yeast, Bovine, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GNB2L1 antibody
- ARP40624_P050
Peptide Sequence:
Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
Blocking Peptide:
For anti-GNB2L1 antibody is Catalog # AAP40624 (Previous Catalog # AAPP22384)
Key Reference:
Parent,A., (2008) Traffic 9 (3), 394-407
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GNB2L1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question