CRKL Antibody - middle region (ARP30524_P050)

Catalog#: ARP30524_P050

• Size: 50ug

Human K562

• Description of Target: CRKL has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase and plays a role in fibroblast transformation by BCR-ABL. In addition, CRKL has oncogenic potential.
• Gene Symbol: CRKL
• Alias Symbols: -
• Protein Accession#: NP_005198
• Nucleotide Accession#: NM_005207
• Swissprot Id: P46109
• Host: Rabbit
• Protein Size (# AA): 303
• Molecular Weight: 34kDa
• Application: WB
• Partner Proteins: DNM2,MAP4K1,RAPGEF1,SYK,WAS,WIPF1,ZAP70,ABL1,ARHGAP32,BCAR1,BCR,BLNK,CBL,CBLB,CD34,CRK,DAB1,DOCK2,DOK1,EPHB6,EPOR,EVL,FCGR1A,GAB1,GAB2,GRB2,IFNAR1,IGF1R,INPP5D,INSR,IRS4,ITGB1,KIDINS220,KIT,LYN,MAP4K1,MAP4K5,NEDD9,PDGFRA,PIK3R1,PIK3R2,PTPN11,PXN,RAPGEF1,SHC1,SOS1,SOS2,STAT5A,STAT5B,SYK,TGFB1I1,TYK2,WAS,WIPF1,ABL1,ANK3,ARHGAP32,BCAR1,BCR,BLNK,CBL,CBLB,CD34,DOCK2,DOK1,EPOR,ETV6,FCGR1A,GAB1,GAB2,GRB2,INPP5D,IRS4,KIT,MAP4K1,MAP4K5,NEDD9,PDGFRA,PIK3R1,PIK3R2,PTEN,PTPN11,PXN,RAPGEF1,SHC1,STAT5A,SYK,TYK2,UBC,USP7,WAS
• Immunogen: The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS
• Blocking Peptide: Catalog # AAP30524
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-CRKL Antibody (ARP30524_P050) concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.