website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CRK antibody - C-terminal region (ARP30416_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30416_P050-FITC Conjugated

ARP30416_P050-HRP Conjugated

ARP30416_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
V-crk sarcoma virus CT10 oncogene homolog (avian)
Protein Name:
Adapter molecule crk
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CRKII, p38
Replacement Item:
This antibody may replace item sc-110474 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRK.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-CRK (ARP30416_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CRK (ARP30416_P050) antibody is Catalog # AAP30416
Datasheets / Downloads:
Printable datasheet for anti-CRK (ARP30416_P050) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...