website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

CRK antibody - C-terminal region (ARP30416_P050)

Receive a free blocking peptide (AAP30416) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Gene Symbol:
CRK
Official Gene Full Name:
V-crk sarcoma virus CT10 oncogene homolog (avian)
NCBI Gene Id:
1398
Alias Symbols:
CRKII; p38
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRK.
Swissprot Id:
P46108
Protein Accession #:
NP_058431
Nucleotide Accession #:
NM_016823
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Adapter molecule crk
Protein Size (# AA):
304
Molecular Weight:
34kDa
Application:
WB
Protein Interactions:
FAM154A; HUWE1; ABL2; ABL1; SPRR2A; MET; CBL; BAG3; LMNA; ERBB3; ERBB2; EGFR; PPFIBP2; ATXN1; PTPN4; MAPK4; DOK1; BCAR1; NANS; FUBP1; SPR; HSPB1; DHX9; SERPINH1; ATIC; PIK3R2; PIK3R1; PIK3CD; PIK3CB; PIK3CA; PIK3C2B; SERPINB6; LYZ; KRT19; KRT17; KRT16; KR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-CRK (ARP30416_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rat
Datasheets / Downloads:
Printable datasheet for anti-CRK (ARP30416_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
Blocking Peptide:
For anti-CRK (ARP30416_P050) antibody is Catalog # AAP30416
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question