website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

CRK antibody - C-terminal region (ARP30416_P050)

Description of Target:
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Gene Symbol:
CRK
Official Gene Full Name:
V-crk sarcoma virus CT10 oncogene homolog (avian)
Alias Symbols:
CRKII; p38
Tissue Tool:
Find tissues and cell lines supported to express CRK.
Protein Accession# :
NP_058431
Nucleotide Accession#:
NM_016823
Swissprot Id:
P46108
Host:
Rabbit
Protein Size (# AA):
304
Molecular Weight:
34kDa
Application:
WB
Partner Proteins:
ZAP70,MAP4K1,ABL1,ABL2,ABL2,PDGFRB,ZAP70,ABL1,ABL2,ARHGAP32,ATXN1,AVIL,BCAR1,BCR,BUB1,CBL,CBLC,CRKL,DAB1,DOCK1,DOCK3,DOK4,DPPA4,EGFR,EPHA3,EPHB3,EPHB6,EPS15,ERBB4,FGFR1,FLT1,FRS2,FYN,GAB1,GRB2,IGF1R,INSR,IRS1,IRS2,IRS4,KDR,KIT,MAP4K1,MAP4K5,MAPK8,NCK1,NEDD9,NTRK1,PDGFRA,PDGFRB,PIK3R1,PLSCR1,PSMC6,PTK2,PTK2B,PXN,RAPGEF1,REPS1,RET,SH3BP1,SHB,SHC1,SOS1,STAT5A,STAT5B,SYN1,VAV1,WASF1,WEE1,XPO1,ZAP70,ABL1,ARHGAP17,ARHGAP32,ARHGAP32,ASAP1,ASAP1,AVIL,BCAR1,BUB1,CBL,CBLC,DOCK1,DOK4,DPPA4,EGFR,EPHA3,EPHB2,EPHB3,EPS15,ERBB4,FRS2,GRB2,IRS4,KCNIP3,KHDRBS1,MAP4K1,MAP4K5,MAPK8,MICAL1,NCK1,NEDD9,PDGFRA,PDGFRB,PLSCR1,PSMC6,PTK2,PTPN1,PXN,RAPGEF1,RET,SH3BP1,SH3KBP1,SHB,SOCS1,SOS1,SRC,SRCIN1,SYN1,VAV2,WEE1,XPO1,ZAP70,xpo1
Product Format:
Lyophilized powder
Complete computational species homology data:
CRK antibody - C-terminal region (ARP30416_P050)
Predicted Homology Based on Immunogen Sequence:
African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 90%
Datasheets / Downloads:
Printable datasheet for
anti-CRK antibody
- ARP30416_P050
Peptide Sequence:
Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
Blocking Peptide:
For anti-CRK antibody is Catalog # AAP30416
Key Reference:
N/A
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-CRK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.