website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


CRK antibody - C-terminal region (ARP30416_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    V-crk sarcoma virus CT10 oncogene homolog (avian)
    Protein Name:
    Adapter molecule crk
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    CRKII, p38
    Description of Target:
    This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express CRK.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express CRK.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-CRK (ARP30416_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-CRK (ARP30416_P050) antibody is Catalog # AAP30416
    Datasheets / Downloads:
    Printable datasheet for anti-CRK (ARP30416_P050) antibody
    Ask a Question