website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CRK antibody - C-terminal region (ARP30416_P050)

  • Catalog#: ARP30416_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30416_P050-FITC Conjugated

    ARP30416_P050-HRP Conjugated

    ARP30416_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    CRK
    NCBI Gene Id:
    1398
    Official Gene Full Name:
    V-crk sarcoma virus CT10 oncogene homolog (avian)
    Protein Name:
    Adapter molecule crk
    Swissprot Id:
    P46108
    Protein Accession #:
    NP_058431
    Nucleotide Accession #:
    NM_016823
    Alias Symbols:
    CRKII, p38
    Replacement Item:
    This antibody may replace item sc-110474 from Santa Cruz Biotechnology.
    Description of Target:
    This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
    Protein Size (# AA):
    304
    Molecular Weight:
    34kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express CRK.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express CRK.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-CRK (ARP30416_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    FAM154A; HUWE1; ABL2; ABL1; SPRR2A; MET; CBL; BAG3; LMNA; ERBB3; ERBB2; EGFR; PPFIBP2; ATXN1; PTPN4; MAPK4; DOK1; BCAR1; NANS; FUBP1; SPR; HSPB1; DHX9; SERPINH1; ATIC; PIK3R2; PIK3R1; PIK3CD; PIK3CB; PIK3CA; PIK3C2B; SERPINB6; LYZ; KRT19; KRT17; KRT16; KR
    Blocking Peptide:
    For anti-CRK (ARP30416_P050) antibody is Catalog # AAP30416
    Datasheets / Downloads:
    Printable datasheet for anti-CRK (ARP30416_P050) antibody
     
    X
    Ask a Question