website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CRK antibody - C-terminal region (ARP30416_P050)

Receive a free blocking peptide (AAP30416) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described.
Gene Symbol:
Official Gene Full Name:
V-crk sarcoma virus CT10 oncogene homolog (avian)
NCBI Gene Id:
Alias Symbols:
CRKII; p38
Tissue Tool:
Find tissues and cell lines supported to express CRK.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Adapter molecule crk
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Complete computational species homology data:
CRK antibody - C-terminal region (ARP30416_P050)
Predicted Homology Based on Immunogen Sequence:
African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 90%
Species Reactivity:
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Rat
Datasheets / Downloads:
Printable datasheet for
anti-CRK antibody
- ARP30416_P050
Peptide Sequence:
Synthetic peptide located within the following region: IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP
Blocking Peptide:
For anti-CRK antibody is Catalog # AAP30416
Target Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CRK antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for CRK antibody (ARP30416)

Product page for CRK antibody (ARP30416)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog CRK antibody; Xenopus laevis CRK antibody P87378 100%
African clawed frog crk2 antibody; Xenopus laevis crk2 antibody Q6PAB9 100%
African elephant CRK antibody; Loxodonta africana CRK antibody G3TYX5 100%
African elephant LOC100659273 antibody; Loxodonta africana LOC100659273 antibody G3T5V2 100%
Bovine CRK antibody; Bos taurus CRK antibody E1BQ32 100%
Chicken CRK antibody; Gallus gallus CRK antibody Q04929 90%
Chinese hamster LOC100762827 antibody; Cricetulus griseus LOC100762827 antibody G3HTF8 100%
Common turkey CRK antibody; Meleagris gallopavo CRK antibody G1MZN9 90%
Dog CRK antibody; Canis familiaris CRK antibody E2QWD3 100%
Duckbill platypus CRK antibody; Ornithorhynchus anatinus CRK antibody F7CN48 100%
Duckbill platypus CRK antibody; Ornithorhynchus anatinus CRK antibody F7CN41 100%
Gray short-tailed opossum CRK antibody; Monodelphis domestica CRK antibody F7D8F3 100%
Gray short-tailed opossum CRK antibody; Monodelphis domestica CRK antibody F6SU50 100%
Guinea pig CRK antibody; Cavia porcellus CRK antibody H0V8T5 100%
Horse CRK antibody; Equus caballus CRK antibody F7BME5 100%
Human CRK antibody; Homo sapiens CRK antibody P46108 100%
Little brown bat CRK antibody; Myotis lucifugus CRK antibody G1NYI2 100%
Lowland gorilla CRK antibody; Gorilla gorilla gorilla CRK antibody G3QV45 100%
Mouse CRK antibody; Mus musculus CRK antibody Q64010 100%
Mouse Crk antibody; Mus musculus Crk antibody Q920I1 100%
Mouse Crk antibody; Mus musculus Crk antibody Q91VM1 100%
Mouse Crk antibody; Mus musculus Crk antibody Q8BPE7 100%
Mouse Crk antibody; Mus musculus Crk antibody Q5ND51 100%
Mouse Crk antibody; Mus musculus Crk antibody F7D232 100%
Mouse Crk antibody; Mus musculus Crk antibody A9J904 100%
Northern white-cheeked gibbon CRK antibody; Nomascus leucogenys CRK antibody G1QIV7 100%
Rabbit LOC100358552 antibody; Oryctolagus cuniculus LOC100358552 antibody G1SIG2 100%
Rat CRK antibody; Rattus norvegicus CRK antibody Q63768 100%
Small-eared galago CRK antibody; Otolemur garnettii CRK antibody H0WTK8 100%
Western clawed frog crk antibody; Xenopus tropicalis crk antibody Q6GLF5 100%
Western clawed frog crk antibody; Xenopus tropicalis crk antibody F6XER9 100%
White-tufted-ear marmoset LOC100399916 antibody; Callithrix jacchus LOC100399916 antibody F7DT53 100%
White-tufted-ear marmoset LOC100399916 antibody; Callithrix jacchus LOC100399916 antibody F7DCK2 100%
Zebra finch CRK antibody; Taeniopygia guttata CRK antibody H0Z4T7 90%
Ask a Question