- Description of Target:
- Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.
- Gene Symbol:
- CKMT2
- Official Gene Full Name:
- Creatine kinase, mitochondrial 2 (sarcomeric)
- Alias Symbols:
- SMTCK
- Tissue Tool:
- Find tissues and cell lines supported to express CKMT2.

- Protein Accession# :
- NP_001816
- Nucleotide Accession#:
- NM_001825
- Swissprot Id:
- P17540
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 419
- Molecular Weight:
- 43kDa
- Application:
- WB
- Partner Proteins:
- CAPN1, AURKB, CAPN1, DSP, NEB, PKD1, ROCK1, S100A1, S100B, SHBG, SPTAN1, SYNC, SYNM, TRIM7, DSP, NEB, S100A1, SPTAN1, SYNC, SYNM
- Immunogen:
- The immunogen for anti-CKMT2 antibody: synthetic peptide directed towards the C terminal of human CKMT2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CKMT2 antibody - C-terminal region (ARP41479_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Pig: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-CKMT2 antibody
- ARP41479_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
- Blocking Peptide:
- For anti-CKMT2 antibody is Catalog # AAP41479 (Previous Catalog # AAPS09401)
- Key Reference:
- Kim,J.S., (2007) Clin. Cancer Res. 13 (3), 1019-1028
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CKMT2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CKMT2 antibody tested with Human Fetal Heart Tissue (ARP41479_P050)
Aviva Systems Biology is the original manufacturer of this CKMT2 antibody (ARP41479_P050)
Click here to view the CKMT2 antibody Western Blot Protocol
Product Datasheet Link: CKMT2 antibody (ARP41479_P050)
WB Suggested Anti-CKMT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Heart
Western Blot image: 
Description of Target: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CKMT2 antibody (ARP41479_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


