- Description of Target:
- ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
- Gene Symbol:
- ZNF423
- Official Gene Full Name:
- Zinc finger protein 423
- Alias Symbols:
- Ebfaz; KIAA0760; MGC138520; MGC138522; OAZ; Roaz; ZFP423; Zfp104
- Tissue Tool:
- Find tissues and cell lines supported to express ZNF423.
- Protein Accession# :
- NP_055884
- Nucleotide Accession#:
- NM_015069
- Swissprot Id:
- Q2M1K9
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 1284
- Molecular Weight:
- 144kDa
- Application:
- WB
- Partner Proteins:
- CCNT1, PDK2
- Immunogen:
- The immunogen for anti-ZNF423 antibody: synthetic peptide directed towards the middle region of human ZNF423
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- ZNF423 antibody - middle region (ARP39167_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%; Zebrafish: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-ZNF423 antibody
- ARP39167_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA
- Blocking Peptide:
- For anti-ZNF423 antibody is Catalog # AAP39167 (Previous Catalog # AAPP21274)
- Key Reference:
- Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ZNF423 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ZNF423 antibody tested with Human Ht1080 Cells (ARP39167_P050)
Aviva Systems Biology is the original manufacturer of this ZNF423 antibody (ARP39167_P050)
Click here to view the ZNF423 antibody Western Blot Protocol
Product Datasheet Link: ZNF423 antibody (ARP39167_P050)
WB Suggested Anti-ZNF423 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080
Western Blot image: 
Description of Target: ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ZNF423 antibody (ARP39167_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
